Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2114 (AF_2114)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
AF_2114; Uncharacterized protein AF_2114
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-274
Protein Length
Full Length of Mature Protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2114
Target Protein Sequence
AELHFQVFIKGYNGTAELGIFGENLSKVETVKNGSIISLPAGNYTLTLFALNKTFVKDLR LDSNKTVTFNLLFTNRTENLSMMRHAIVQPSLEVFEIVLITNSGGENFEGDLAIPLPEHT GLKISDSSLSFLDFSDLNGNLTLKKLIVPANSTGEVSITYRLVKPKLSLSGAENQTVLIF TTLPVTNQSNAAYRGVQQFKGVDYSVYQCKTKCVLEFKVEPEIKIDKTSAFVILTASALI FIYLFTKRGGWEK
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2114

STRING: 224325.AF2114

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant for protein studies?

Archaeoglobus fulgidus is a hyperthermophilic archaeon that grows optimally at temperatures around 83°C and was first isolated from marine hydrothermal vents. Its significance lies in its unique adaptations to extreme environments and its evolutionary position within the archaeal domain. A. fulgidus proteins, such as AF_2114, are particularly valuable for understanding protein stability at high temperatures and extreme conditions. The organism's genome has been fully sequenced, revealing numerous proteins with no characterized homologs in other domains of life. Studying uncharacterized proteins like AF_2114 provides insights into novel biochemical pathways and potential biotechnological applications that exploit thermostability. The research approach typically begins with genomic analysis, followed by recombinant expression and biochemical characterization, which provides a foundation for understanding the broader archaeal proteome .

What are the optimal expression systems for recombinant AF_2114 production?

When expressing A. fulgidus proteins like AF_2114, several expression systems can be utilized, each with specific advantages depending on research goals:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli (BL21)High yield, simple protocol, economicalPotential misfolding of archaeal proteins, lack of post-translational modifications10-50 mg/L
E. coli RosettaBetter handling of rare codons found in archaeal genesHigher cost than standard strains8-40 mg/L
Yeast (P. pastoris)Eukaryotic folding machinery, good for secreted proteinsLonger expression time, more complex protocols5-20 mg/L
Cell-free systemsRapid expression, direct control over reaction conditionsLower yield, higher cost0.5-5 mg/L

For AF_2114, the recommended methodological approach begins with codon optimization for the chosen expression system, followed by cloning into a suitable vector with an affinity tag (typically His6). Expression conditions should be optimized based on small-scale trials, testing variables such as temperature (typically lowered to 16-20°C during induction), inducer concentration, and duration. For archaeal proteins, including chaperones or using specialized strains like Arctic Express can improve folding. Based on studies with other A. fulgidus proteins, E. coli-based systems with careful optimization of induction parameters often provide the best balance of yield and properly folded protein .

How should researchers design initial characterization experiments for AF_2114?

Initial characterization of uncharacterized proteins like AF_2114 requires a methodical approach that combines biophysical and biochemical techniques. The experimental design should follow this sequence:

  • Purification quality assessment: SDS-PAGE, size exclusion chromatography, and mass spectrometry to confirm protein identity and purity.

  • Stability analysis: Differential scanning fluorimetry (DSF) or circular dichroism (CD) to determine thermal stability profiles under various buffer conditions.

  • Structural characterization: CD spectroscopy for secondary structure content, followed by crystallization trials if high-resolution structural information is desired.

  • Preliminary functional screens: ATP/GTP binding assays, metal binding analysis, and substrate screening based on bioinformatic predictions.

  • Interaction partner identification: Pull-down assays or bacterial two-hybrid screens to identify potential protein partners.

This systematic approach allows researchers to gather fundamental data about AF_2114 before moving to more targeted functional studies. Each experiment should include appropriate controls, including well-characterized proteins from A. fulgidus with known properties. The experimental design should account for the thermophilic nature of the organism, ensuring that assay conditions include elevated temperature trials (60-85°C) alongside standard temperatures to observe potential temperature-dependent activities .

What computational approaches can predict the function of AF_2114?

Computational prediction of AF_2114 function requires a multi-layered approach combining various bioinformatic tools and algorithms:

ApproachToolsOutputConfidence Level
Sequence homologyBLAST, HMMERIdentification of similar characterized proteinsHigh (>40% identity), Low (<25% identity)
Structural predictionAlphaFold2, RoseTTAFold3D structure models, domain identificationMedium-High (depends on model confidence)
Genomic contextGene neighborhood analysis, operonsFunctional associations, metabolic pathwaysMedium
Evolutionary analysisPhylogenetic profiling, evolutionary rateConservation patterns, functional constraintsMedium
Integrative predictionInterPro, SUPERFAMILYDomain architecture, functional classificationMedium-High

The methodological workflow should begin with basic sequence analysis using PSI-BLAST and HHpred to identify remote homologs. For truly novel proteins like potentially AF_2114, structure prediction using modern AI-based tools like AlphaFold2 has proven particularly valuable, as structure often reveals functional clues even when sequence provides none. After obtaining a predicted structure, researchers should analyze potential binding pockets or active sites using tools like CASTp or COACH, which can suggest substrate binding capabilities.

Crucially, these computational predictions must be treated as hypotheses to be experimentally validated. The integration of multiple prediction methods improves confidence but cannot replace biochemical characterization. Researchers should design targeted assays based on the highest-confidence predictions, starting with simple activity tests and progressing to more complex functional analyses as initial results dictate .

How do experimental designs differ when characterizing thermostable proteins like AF_2114?

Experimental design for thermostable proteins from A. fulgidus requires significant modifications compared to mesophilic proteins:

  • Buffer stability considerations: Standard buffers like Tris have high temperature coefficients, making HEPES, phosphate, or MES preferable for thermostable protein work. Buffer pH should be measured at the actual experimental temperature, accounting for temperature-dependent pH shifts.

  • Equipment modifications: Water baths or heating blocks must be used for enzymatic assays instead of room temperature incubation. Specialized equipment like high-temperature circular dichroism cells or thermostable cuvettes may be required.

  • Kinetic considerations: Reaction rates typically increase with temperature, requiring shorter timepoints and potentially more sensitive detection methods. Calibration curves should be performed at the same temperatures as experimental conditions.

  • Stability control experiments: Include parallel assays at various temperatures (25°C, 50°C, 70°C, 85°C) to determine temperature optima and establish the relationship between structure and function at different temperatures.

  • Extended storage testing: Evaluate protein stability after multiple freeze-thaw cycles and during extended storage at various temperatures to establish handling protocols.

The experimental design should employ a randomized block design (RBD) approach, where temperature serves as the blocking factor. This design effectively accounts for temperature-related variations while efficiently testing multiple experimental conditions (such as buffer composition, pH, or substrate concentration). For each condition, reactions should be prepared in replicate sets assigned to different temperature blocks to distinguish temperature effects from other experimental variables .

What structural analysis methods are most effective for uncharacterized archaeal proteins?

Structural analysis of uncharacterized archaeal proteins like AF_2114 requires an integrated approach combining multiple techniques:

For thermostable proteins like those from A. fulgidus, X-ray crystallography often proves highly effective as these proteins typically form stable, well-diffracting crystals. The experimental approach should include crystallization screening at both standard and elevated temperatures (30-60°C), as archaeal proteins may crystallize differently at temperatures closer to their physiological conditions. If crystallization proves challenging, cryo-EM is an excellent alternative, particularly if AF_2114 forms higher-order assemblies or has multiple domains.

Importantly, structural analysis should be performed in the presence and absence of potential cofactors, substrates, or interaction partners identified through bioinformatic analysis or preliminary functional screens. This comparative approach often reveals binding sites and conformational changes that provide crucial insights into function .

How can protein-protein interaction studies help elucidate the function of AF_2114?

Protein-protein interaction (PPI) studies provide crucial insights into the functional context of uncharacterized proteins like AF_2114. The methodological approach should combine multiple complementary techniques:

  • Affinity purification coupled with mass spectrometry (AP-MS): This approach involves expressing tagged AF_2114 in either a recombinant system or, ideally, in A. fulgidus itself if genetic tools are available. After crosslinking and pull-down, interacting partners are identified by mass spectrometry. For thermophilic organisms, performing crosslinking at elevated temperatures (60-85°C) is crucial to capture physiologically relevant interactions.

  • Yeast two-hybrid (Y2H) or bacterial two-hybrid (B2H) screening: While these systems operate at lower temperatures than A. fulgidus' natural environment, they can identify strong interactions that persist under mesophilic conditions. Screening should use A. fulgidus genomic libraries to identify all potential interaction partners.

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): These techniques provide quantitative binding kinetics for candidate interactions identified through screens. For thermostable proteins, modified instruments capable of elevated temperature measurements should be used when available.

  • Structural studies of complexes: Co-crystallization or cryo-EM analysis of AF_2114 with identified partners can reveal interaction interfaces and conformational changes upon binding.

Based on studies with other A. fulgidus proteins, a systematic approach would begin with identifying potential interactors of AF_2114 through AP-MS, followed by validation of specific interactions using targeted approaches like co-immunoprecipitation or SPR. Studies of the Trm11-Trm112 complex from A. fulgidus demonstrated that archaeal proteins often form functional complexes similar to their eukaryotic homologs, but with unique thermostability properties and sometimes different regulatory mechanisms .

What approaches should be used to resolve contradictory results in AF_2114 characterization?

When facing contradictory results in the characterization of uncharacterized proteins like AF_2114, researchers should implement a systematic troubleshooting approach:

  • Protein quality assessment: Verify protein folding, stability, and homogeneity using multiple techniques (CD, DSF, SEC-MALS, native PAGE). Contradictory functional results often stem from variable proportions of properly folded protein.

  • Buffer and reaction condition standardization: Develop a comprehensive set of standard operating procedures (SOPs) with precisely defined buffer compositions, pH (measured at experimental temperature), salt concentrations, and reducing agent concentrations.

  • Temperature effects analysis: For thermophilic proteins, perform all experiments across a temperature gradient (25°C, 40°C, 60°C, 80°C) to identify temperature-dependent behaviors that might explain discrepancies.

  • Experimental design review: Implement Latin Square Design (LSD) for complex multi-factor experiments to systematically control for confounding variables:

TemperatureBuffer ABuffer BBuffer CBuffer D
25°CSample 1Sample 2Sample 3Sample 4
45°CSample 2Sample 3Sample 4Sample 1
65°CSample 3Sample 4Sample 1Sample 2
85°CSample 4Sample 1Sample 2Sample 3
  • Inter-laboratory validation: Establish collaborations with other research groups to independently verify key results using identical protocols but different laboratory environments and equipment.

  • Alternative method cross-validation: For each contradictory result, apply at least two independent methodological approaches to measure the same parameter.

  • Data integration and statistical analysis: Apply meta-analysis techniques to integrate all available data, weighting results based on methodological rigor and reproducibility.

This systematic approach helps identify whether contradictions stem from technical issues, biological variability, or genuine condition-dependent behaviors of the protein. For archaeal proteins like AF_2114, contradictory results often reflect differential activities under various temperature and salt conditions, which may actually provide insights into the protein's native function and regulation mechanisms .

What are the optimal buffer systems for studying AF_2114 enzymatic activity?

Designing buffer systems for A. fulgidus proteins requires special consideration of temperature stability and physiological relevance:

Buffer TypeUseful pH RangeΔpH/°CRecommended ConcentrationsCompatible Additives
Phosphate6.0-8.0-0.002850-100 mMNaCl, glycerol, reducing agents
HEPES6.8-8.2-0.01425-50 mMDTT, metals (except Cu²⁺)
MOPS6.5-7.9-0.01125-50 mMMost additives
MES5.5-6.7-0.01125-50 mMMost metals, reducing agents
Bicine7.6-9.0-0.01825-50 mMModerate salt concentrations

The methodological approach should begin with a buffer matrix experiment testing protein stability across different buffer types, pH values, and salt concentrations using DSF or activity assays. For AF_2114, initial screening should include conditions that mimic the cytoplasmic environment of A. fulgidus: slightly acidic to neutral pH (pH 6.0-7.0), moderate salt concentrations (200-500 mM KCl or NaCl), and reducing conditions (1-5 mM DTT or TCEP).

Given A. fulgidus' hyperthermophilic nature, all buffers should be prepared with consideration for pH shifts at elevated temperatures. For example, if assays will be performed at 80°C, the buffer should be prepared at room temperature with a pH adjustment that accounts for the expected pH shift at the experimental temperature.

Additionally, enzyme assays should include potential cofactors based on bioinformatic predictions: common archaeal cofactors include various metal ions (Mg²⁺, Mn²⁺, Fe²⁺, Zn²⁺), nucleotides (ATP, GTP), and coenzymes (NAD⁺, FAD). By systematically testing these conditions, researchers can identify optimal buffer compositions that maintain protein stability while supporting native enzymatic function .

How can researchers distinguish between protein function and artifacts in thermostable protein assays?

Distinguishing genuine enzymatic activity from artifacts is particularly challenging when working with thermostable proteins like AF_2114. A comprehensive methodological approach includes:

  • Comprehensive controls:

    • Heat-denatured protein control (protein heated beyond its denaturation temperature)

    • Active site mutant controls (if putative active site residues can be predicted)

    • Buffer-only reactions to identify non-enzymatic chemical reactions accelerated by high temperatures

    • Substrate-only controls at experimental temperatures

  • Temperature-dependent kinetics analysis:

    • Perform assays across a temperature gradient (25-90°C)

    • Calculate activation energy using Arrhenius plots

    • Compare with known enzymatic vs. non-enzymatic reactions (enzymatic reactions typically show lower activation energies)

  • Substrate specificity profiling:

    • Test structurally similar substrates

    • Genuine enzymatic activity typically shows preference for specific substrates

    • Non-specific chemical catalysis shows less substrate discrimination

  • Inhibition studies:

    • Test specific inhibitors if predicted by homology

    • Analyze competitive vs. non-competitive inhibition patterns

    • Chemical artifacts typically don't follow classical enzyme inhibition models

  • Alternative assay methods:

    • Use at least two independent assay techniques to measure the same activity

    • Direct product formation measurement (HPLC, MS) alongside spectrophotometric assays

    • Isothermal titration calorimetry to measure heat of reaction

By implementing these methodological controls and analyses, researchers can confidently distinguish between genuine AF_2114 activity and temperature-accelerated chemical reactions. This approach has successfully identified true functions of other thermostable enzymes from A. fulgidus, while avoiding mischaracterization due to artifacts .

What approaches can determine if AF_2114 forms functional complexes with other A. fulgidus proteins?

Based on studies of other A. fulgidus proteins, such as the Trm11-Trm112 complex, determining whether AF_2114 forms functional complexes requires a multi-faceted approach:

  • Co-expression and co-purification studies:

    • Design co-expression constructs with putative partners identified through genomic context analysis

    • Compare purification profiles of individually expressed vs. co-expressed proteins

    • Analyze stability and solubility improvements as indicators of complex formation

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS):

    • Determine precise molecular weight of purified complexes

    • Identify stoichiometry of component proteins

    • Compare SEC profiles at different temperatures to assess complex stability

  • Native mass spectrometry:

    • Direct measurement of intact complexes

    • Identification of subcomplexes and assembly intermediates

    • Analysis of non-covalent interactions

  • Functional complementation assays:

    • Compare enzymatic activity of individual proteins vs. reconstituted complexes

    • Analyze kinetic parameters to quantify functional enhancement

    • Test temperature dependence of complex-mediated activity enhancement

  • Structural studies of complexes:

    • Co-crystallization trials

    • Cryo-EM analysis of larger assemblies

    • Crosslinking mass spectrometry to identify interaction interfaces

Based on the study of Trm11-Trm112 complex from A. fulgidus, researchers observed that while some archaeal proteins can function independently, their activity is significantly enhanced through complex formation with partner proteins. For AF_2114, researchers should test whether its activity changes in the presence of genomically co-localized proteins or proteins identified through pull-down assays. The experimental approach should include activity assays of the individual protein compared with the reconstituted complex under various temperature and buffer conditions .

What integrated research strategy would most efficiently characterize AF_2114?

The most efficient research strategy for characterizing AF_2114 would integrate computational, biochemical, and structural approaches in a systematic workflow:

Phase 1: Computational Analysis and Hypothesis Generation

  • Comprehensive bioinformatic analysis including structural prediction with AlphaFold2

  • Genomic context analysis to identify potential functional associations

  • Design of targeted expression constructs based on domain predictions

Phase 2: Protein Production and Initial Characterization

  • Parallel expression trials in multiple systems

  • Biochemical characterization (stability, oligomeric state)

  • Preliminary functional screens based on bioinformatic predictions

Phase 3: Structural Studies

  • Medium-resolution techniques (SAXS, CD) for all constructs

  • High-resolution structural analysis of most promising constructs

  • Structure-guided functional site identification

Phase 4: Functional Validation

  • Targeted biochemical assays based on structural insights

  • Mutagenesis of predicted functional residues

  • Complex formation studies with predicted partners

This integrated approach ensures efficient resource allocation by using computational predictions to guide experimental design, while maintaining flexibility to explore unexpected findings. The strategy prioritizes multiple parallel paths of investigation, allowing researchers to quickly pivot based on preliminary results. For thermostable proteins like AF_2114, this approach has proven effective in identifying novel functions that might not be apparent from sequence analysis alone .

How might AF_2114 characterization contribute to understanding archaeal biology?

The characterization of uncharacterized proteins like AF_2114 from A. fulgidus has significant implications for broader understanding of archaeal biology:

  • Evolutionary insights: Detailed structural and functional analysis of AF_2114 may reveal evolutionary relationships that sequence analysis alone cannot detect, potentially identifying "functional analogs" rather than homologs across domains of life.

  • Adaptation mechanisms: Understanding the structural features that confer thermostability in AF_2114 contributes to our knowledge of molecular adaptations to extreme environments.

  • Metabolic network reconstruction: Functional characterization of AF_2114 may fill gaps in current metabolic models of A. fulgidus, potentially identifying novel pathways unique to archaea.

  • Protein-protein interaction networks: Identification of AF_2114 interaction partners helps map the archaeal interactome, revealing regulatory networks and functional modules.

  • Domain architecture innovations: Structural analysis may reveal novel domain arrangements or modifications that contribute to specialized archaeal functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.