Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2122 (AF_2122)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2122 (AF_2122)

Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2122 (AF_2122) is a protein derived from the archaeon Archaeoglobus fulgidus, a thermophilic microorganism known for its ability to metabolize sulfur and thrive in extremely high temperatures. The protein AF_2122 is expressed in Escherichia coli (E. coli) and is tagged with a His-tag for purification purposes. Despite its uncharacterized nature, this protein has been studied in various contexts, including its recombinant expression and potential applications in biotechnology.

Characteristics of Recombinant AF_2122 Protein

The recombinant AF_2122 protein is a full-length protein consisting of 142 amino acids, with a His-tag attached to facilitate purification. It is provided in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE. The protein is stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, it is recommended to store the protein at -20°C or -80°C, avoiding repeated freeze-thaw cycles.

CharacteristicsDescription
SpeciesArchaeoglobus fulgidus
SourceEscherichia coli
TagHis-tag
Protein LengthFull Length (1-142 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Conditions-20°C or -80°C, avoid repeated freeze-thaw cycles

Amino Acid Sequence and Structure

The amino acid sequence of AF_2122 is as follows: MPIAAATDFALNAILRPISDIFVLIYGLLEPINAHLIPEHTNFIYGQLSLLLWGTKFLATILGVTANNATAMANFTDVLHTLSENSYHFFGTVEGESGMAYIAKHSYIELSQNQQLSEDM AVKFARAVNSTIIYFVKVFEYL. This sequence provides insights into the protein's potential structure and function, although its exact role remains uncharacterized.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AF_2122; Uncharacterized protein AF_2122
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2122
Target Protein Sequence
MPIAAATDFALNAILRPISDIFVLIYGLLEPINAHLIPEHTNFIYGQLSLLLWGTKFLAT ILGVTANNATAMANFTDVLHTLSENSYHFFGTVEGESGMAYIAKHSYIELSQNQQLSEDM AVKFARAVNSTIIYFVKVFEYL
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2122

STRING: 224325.AF2122

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of AF_2122 in Archaeoglobus fulgidus?

AF_2122 is encoded in the genome of A. fulgidus, a sulfate-reducing archaeon that was fully sequenced in 1997 . While specific information about AF_2122's genomic neighborhood is limited in the provided search results, examining its genomic context is crucial for functional prediction. In A. fulgidus and related organisms, genes with related functions are often co-located in operons or gene clusters, as seen with the lactate dehydrogenase genes (lldD, dld, lldEFG) described in the search results . Researchers should analyze whether AF_2122 is located near genes involved in specific metabolic pathways, such as sulfate reduction, hydrogen metabolism, or carbon fixation.

How might AF_2122 relate to the energy metabolism of A. fulgidus?

A. fulgidus possesses a sophisticated energy metabolism that enables growth under various conditions. The organism can grow heterotrophically using lactate with either sulfate or thiosulfate as terminal electron acceptors, or lithoautotrophically using H₂ with thiosulfate (but not sulfate) . Key components of its energy conservation system include:

  • F₄₂₀H₂:quinone oxidoreductase (Fqo) complex

  • Membrane-bound heterodisulfide reductase (Hdr) complexes (DsrMK, DsrMKJOP)

  • Quinone-interacting membrane-bound oxidoreductase (QmoABC)

AF_2122 could potentially function within this network, perhaps as an unrecognized component of one of these complexes or in a regulatory role that modulates energy conservation under different growth conditions .

What expression patterns might AF_2122 exhibit under different growth conditions?

Transcriptomic analysis of A. fulgidus reveals significant differences in gene expression between growth conditions. The search results indicate that 269 genes show differential expression between different energy sources (lactate versus H₂), while 72 genes are differentially expressed between different electron acceptors (sulfate versus thiosulfate) . To understand AF_2122's function, researchers should determine whether it follows expression patterns similar to known components of specific metabolic pathways. For example, if AF_2122 is co-expressed with genes involved in thiosulfate reduction, it might play a role in this pathway.

What computational approaches can predict AF_2122's function?

For uncharacterized proteins like AF_2122, several computational approaches can generate functional hypotheses:

  • Sequence homology searches to identify related proteins with known functions

  • Structural prediction using tools like AlphaFold2, particularly valuable for archaeal proteins with few characterized homologs

  • Domain architecture analysis to identify conserved functional domains

  • Genomic context analysis (examining neighboring genes)

  • Co-expression analysis using existing transcriptomic data from A. fulgidus

These approaches should be integrated to develop a consensus prediction that can guide experimental design.

How is AF_2122 conserved across archaeal species?

Conservation analysis provides important clues about function—proteins involved in essential processes tend to be more widely conserved than those with specialized functions. Researchers should examine whether AF_2122 homologs exist in:

  • Other Archaeoglobus species (e.g., A. sulfaticallidus)

  • Other sulfate-reducing archaea

  • Methanogens (which share some energy conservation mechanisms with A. fulgidus)

  • Thermophilic bacteria with similar metabolic capabilities

The search results mention that some protein complexes, like the LdlEFG complex, are widely distributed in sulfate-reducing Deltaproteobacteria but were previously not identified in Archaea except for Archaeoglobales . AF_2122 could similarly represent a protein whose distribution provides evolutionary insights.

Could AF_2122 be involved in the unique thiosulfate metabolism of A. fulgidus?

A particularly interesting aspect of A. fulgidus metabolism is its ability to use thiosulfate as an electron acceptor during lithoautotrophic growth with H₂, while it cannot use sulfate under these conditions . The search results mention a "putative periplasmic thiosulfate reductase" that was specifically up-regulated during growth with thiosulfate . If AF_2122 is part of this thiosulfate reduction system, it would explain why the protein might be difficult to characterize based on homology alone, as archaeal thiosulfate reduction systems are less well-characterized than sulfate reduction systems.

To investigate this possibility, researchers could:

  • Compare AF_2122 expression between sulfate and thiosulfate growth conditions

  • Examine protein-protein interactions with known components of thiosulfate metabolism

  • Test for thiosulfate reductase activity in vitro with recombinant AF_2122

How might AF_2122 function in the context of A. fulgidus' membrane-bound electron transport complexes?

The search results describe several membrane-bound electron transport complexes in A. fulgidus, including:

ComplexCompositionProposed Function
FqoF₄₂₀H₂:quinone oxidoreductaseOxidizes F₄₂₀H₂, reduces menaquinone, translocates protons
QmoQmoABCLinks electron transport to APS reduction
DsrMKMembrane-bound heterodisulfide reductaseCouples menaquinol oxidation to DsrC reduction
DsrMKJOPExtended heterodisulfide reductase complexSimilar to DsrMK but with additional components

AF_2122 could potentially function as an accessory protein to one of these complexes, perhaps facilitating electron transfer under specific conditions or helping to stabilize complex formation in the hyperthermophilic environment of A. fulgidus .

What structural features might enable AF_2122 to function in a hyperthermophilic environment?

A. fulgidus grows optimally at temperatures around 83°C, requiring its proteins to possess structural adaptations for thermostability. These typically include:

  • Increased numbers of salt bridges

  • Enhanced hydrophobic interactions in the protein core

  • Reduced surface area to volume ratio

  • Strategic placement of disulfide bonds

Structural studies of AF_2122 should analyze these features to understand how the protein maintains stability and function at high temperatures. Additionally, if AF_2122 is involved in redox reactions, as many A. fulgidus proteins are, its structure might include specific adaptations for metal binding or cofactor interactions that are stable at high temperatures .

Could AF_2122 play a role in the carbon metabolism of A. fulgidus?

The search results indicate that A. fulgidus can fix CO₂ through the acetyl-CoA pathway during lithoautotrophic growth with H₂ . Additionally, some genes linked to fatty acid metabolism are induced during growth with H₂/CO₂, and these may form part of the 3-hydroxypropionate/4-hydroxybutyrate pathway of CO₂ assimilation . AF_2122 could potentially function in:

  • The acetyl-CoA pathway of carbon fixation

  • The 3-hydroxypropionate/4-hydroxybutyrate pathway

  • Regulation of carbon metabolism in response to different growth conditions

  • Transport or activation of organic acids

Experimental approaches to test these hypotheses would include metabolic labeling studies and enzyme activity assays with purified recombinant AF_2122.

How might AF_2122 contribute to redox balance in A. fulgidus?

The search results mention several important redox carriers in A. fulgidus metabolism, including:

  • Reduced ferredoxin (Fdred)

  • F₄₂₀H₂

  • Menaquinone

  • Thiol/disulfide conversions involving DsrC

AF_2122 could potentially function in maintaining redox balance by facilitating electron transfer between these carriers or by serving as a redox sensor that regulates metabolism in response to changing redox conditions . Determining whether AF_2122 binds cofactors, contains redox-active centers, or interacts with known redox proteins would be critical for testing this hypothesis.

What insights could proteomics provide about AF_2122's potential post-translational modifications?

Proteins in hyperthermophilic archaea often undergo post-translational modifications that affect their stability, localization, or function. Common modifications include:

  • Glycosylation

  • Phosphorylation

  • Methylation

  • Metal center formation

Proteomic analysis of native AF_2122 could identify such modifications and provide clues about function. For example, if AF_2122 contains iron-sulfur clusters or other metal centers, it might be involved in electron transfer processes similar to the rubrerythrin and desulfoferrodoxin systems mentioned in the search results, which function in elimination of superoxides .

What expression systems are optimal for producing recombinant AF_2122?

Expressing proteins from hyperthermophilic archaea presents unique challenges. For AF_2122, researchers should consider:

Expression Host Options:

Host SystemAdvantagesDisadvantages
E. coli with heat shockWidely accessible, high yieldsMay not fold correctly, potential inclusion bodies
Thermophilic bacteria (e.g., Thermus)Better protein folding at higher temperaturesLower yields, fewer genetic tools available
Archaeal hosts (e.g., Sulfolobus)Native-like post-translational modificationsComplex growth requirements, limited genetic tools

Purification Strategy:

  • Heat treatment (70-80°C) to denature host proteins while leaving thermostable AF_2122 intact

  • Affinity chromatography (His-tag or other fusion tags)

  • Ion exchange chromatography

  • Size exclusion chromatography

The purified protein should be verified for proper folding using circular dichroism spectroscopy and thermal shift assays to confirm thermostability .

What transcriptomic approaches would best reveal AF_2122's expression patterns?

The search results describe the use of whole-genome microarrays to study differential gene expression in A. fulgidus under different growth conditions . Similar approaches, updated with current technology, would be valuable for understanding AF_2122's function:

  • RNA-Seq analysis of A. fulgidus grown under various conditions:

    • Heterotrophic growth with lactate vs. lithoautotrophic growth with H₂

    • Sulfate vs. thiosulfate as electron acceptor

    • Different growth phases (early log, mid-log, stationary)

  • Co-expression network analysis to identify genes with expression patterns similar to AF_2122

  • Quantitative RT-PCR to validate expression changes observed in global transcriptomic studies

These approaches could place AF_2122 within the broader context of A. fulgidus' transcriptional response to different environmental conditions .

What biochemical assays could test potential enzymatic activities of AF_2122?

Without specific functional predictions, a systematic approach to enzymatic characterization would be necessary:

General Activity Screening:

  • Oxidoreductase activity assays (with various electron donors/acceptors)

  • Hydrolase activity assays (with different potential substrates)

  • Transferase activity assays

Specific Activity Tests Based on A. fulgidus Metabolism:

  • Thiosulfate reductase activity

  • Sulfite reductase activity

  • Electron transfer to/from ferredoxin

  • Interaction with F₄₂₀ or derivatives

  • Menaquinone reduction/oxidation

All assays should be conducted at elevated temperatures (75-85°C) to mimic A. fulgidus' native conditions .

How can protein-protein interactions involving AF_2122 be studied under thermophilic conditions?

Standard protein interaction methods must be adapted for thermophilic conditions:

In Vitro Methods:

  • Pull-down assays with thermostable affinity tags

  • Biolayer interferometry or surface plasmon resonance at elevated temperatures

  • Isothermal titration calorimetry at temperatures optimal for A. fulgidus proteins

  • Chemical crosslinking followed by mass spectrometry

Computational Predictions:

  • Protein-protein interaction prediction based on structural models

  • Co-evolution analysis to identify potential interaction partners

These approaches could reveal whether AF_2122 interacts with components of known complexes in A. fulgidus, such as the DsrMK complexes or the Qmo complex described in the search results .

What structural biology techniques are most appropriate for AF_2122 characterization?

Several structural techniques could provide insights into AF_2122's function:

X-ray Crystallography:

  • Requires successful crystallization of recombinant AF_2122

  • Can provide high-resolution structural data

  • Crystallization conditions should mimic the native environment of A. fulgidus where possible

Cryo-electron Microscopy:

  • Particularly valuable if AF_2122 forms part of a larger complex

  • Can visualize the protein in different conformational states

  • May reveal interaction interfaces with other proteins

Nuclear Magnetic Resonance (NMR):

  • Can provide information about protein dynamics

  • Useful for identifying binding sites for substrates or cofactors

  • May be limited by protein size

The structural data should be analyzed for features typical of thermophilic proteins and for potential functional sites, such as catalytic residues or cofactor binding pockets .

How should researchers analyze AF_2122 in the context of A. fulgidus' metabolic network?

Understanding AF_2122's role requires integrating it into the broader metabolic network of A. fulgidus:

  • Metabolic reconstruction should incorporate transcriptomic data showing which pathways are active under different conditions

  • Flux balance analysis could predict how AF_2122 might impact metabolic fluxes

  • Comparative analysis with metabolic networks of related organisms could identify conserved versus unique features

The search results describe several key metabolic modules in A. fulgidus, including:

Metabolic ModuleKey ComponentsFunction
Lactate oxidationLdlEFG, lldD, dldOxidizes lactate, generates electrons for sulfate reduction
Hydrogen oxidationMvh:Hdl hydrogenase, VhtOxidizes H₂, generates Fdred and electrons
Sulfate reductionQmoABC, APS reductase, DsrAB, DsrCReduces sulfate to sulfide, accepts electrons
Thiosulfate reductionPutative periplasmic thiosulfate reductaseReduces thiosulfate, accepts electrons
Carbon fixationAcetyl-CoA pathway enzymesFixes CO₂ using Fdred

Placing AF_2122 within this network would provide a framework for understanding its function .

What approaches can distinguish between direct and indirect effects in AF_2122 functional studies?

When characterizing an uncharacterized protein like AF_2122, distinguishing direct from indirect effects is crucial:

  • In vitro reconstitution with purified components can establish direct biochemical activities

  • Site-directed mutagenesis of predicted functional residues can confirm their importance

  • Time-resolved studies can help establish the sequence of events in complex pathways

  • Genetic complementation studies (if genetic tools become available for A. fulgidus) could verify function in vivo

The search results note that "a genetic system is not yet available for this species," which presents a significant challenge for in vivo functional studies .

How can researchers validate computational predictions about AF_2122?

Computational predictions about AF_2122's function should be systematically validated:

  • Structural predictions can be verified through experimental structure determination

  • Predicted binding sites can be tested through site-directed mutagenesis followed by binding assays

  • Predicted interactions with other proteins can be tested through co-immunoprecipitation or other interaction studies

  • Predicted enzymatic activities can be tested through in vitro activity assays

Each prediction should be treated as a hypothesis to be tested rather than a definitive functional assignment .

What statistical approaches are appropriate for analyzing AF_2122 data from different experimental platforms?

Integrating data from multiple experimental approaches requires robust statistical methods:

  • For transcriptomic data: differential expression analysis with appropriate multiple testing correction

  • For proteomic data: statistical models that account for the technical variability of mass spectrometry

  • For structural data: ensemble approaches that consider multiple possible conformations

  • For evolutionary analyses: phylogenetic models that account for the unique characteristics of archaeal sequence evolution

Meta-analysis approaches can integrate results across different experimental platforms to develop a consensus view of AF_2122's function .

How can researchers address contradictory findings about AF_2122 function?

Contradictory results are common when characterizing uncharacterized proteins and require systematic resolution:

  • Carefully examine differences in experimental conditions (temperature, pH, salt concentration)

  • Consider the possibility of multiple functions or condition-specific functions

  • Validate key findings using complementary techniques

  • Develop quantitative models that can explain apparently contradictory observations

The complex metabolism of A. fulgidus, with multiple electron transfer pathways and condition-specific gene expression, suggests that AF_2122 might have different functions under different growth conditions .

What can comparative genomics reveal about the evolutionary history of AF_2122?

Comparative genomic analysis can provide insights into the evolutionary history and functional significance of AF_2122:

  • Phylogenetic analysis to determine when AF_2122 emerged during archaeal evolution

  • Synteny analysis to examine whether gene neighborhood is conserved across species

  • Selection pressure analysis to identify conserved functional residues

  • Detection of horizontal gene transfer events that might explain AF_2122's distribution

The search results mention that some genes, like the LdlEFG complex, appear to have been acquired by Archaeoglobales and might represent examples of horizontal gene transfer from bacteria . AF_2122 could have a similar evolutionary history.

How does AF_2122 compare to homologous proteins in other extremophiles?

If homologs of AF_2122 exist in other extremophiles, comparing their sequences and structures could reveal adaptations to different extreme environments:

  • Comparison with homologs from thermophilic bacteria

  • Comparison with homologs from halophilic archaea

  • Comparison with homologs from acidophilic or alkaliphilic microorganisms

  • Analysis of environment-specific sequence or structural features

Such comparisons could reveal whether AF_2122 has unique adaptations specific to the hyperthermophilic, sulfate-reducing lifestyle of A. fulgidus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.