Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2124, commonly referred to as AF_2124, is a protein derived from the hyperthermophilic archaeon Archaeoglobus fulgidus. This organism is known for its ability to thrive in extremely high temperatures, typically between 60°C and 95°C, and is involved in sulfur metabolism . The AF_2124 protein is expressed in Escherichia coli and is often used in research due to its unique characteristics and potential roles in various biological pathways.
The AF_2124 protein is a full-length recombinant protein, consisting of 142 amino acids, and is fused with an N-terminal His tag to facilitate purification and detection . This protein is available in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE . The amino acid sequence of AF_2124 is well-defined, allowing for precise structural and functional studies .
| Amino Acid Position | Sequence |
|---|---|
| 1-142 | MNYFLIFLTLLVAVIVEKIEELVAIRFFSSYVLDIARMEAEIEEYKELSMLAMLSGDREA YRGFQDMMNEIYGRVFFRKISFFTPLYFLLLSPYIVALQFLGVENSLSIVLPVAVLYFSA KLFYGMVRDFVKSYVDYRKANN |
AF_2124 is expressed in E. coli, which serves as a common host for recombinant protein production due to its well-understood genetic makeup and ease of manipulation . The protein is purified using affinity chromatography techniques, taking advantage of the His tag for efficient isolation.
While the specific function of AF_2124 remains uncharacterized, it is believed to participate in various cellular processes. Research suggests that proteins like AF_2124 may interact with other molecules and proteins, potentially influencing metabolic pathways or structural integrity within Archaeoglobus fulgidus .
| Pathway Name | Related Proteins |
|---|---|
| Metabolic Processes | Various proteins involved in energy production and metabolism |
KEGG: afu:AF_2124
STRING: 224325.AF2124
AF_2124 is an uncharacterized protein from the hyperthermophilic archaeon Archaeoglobus fulgidus DSM 4304. Based on computational structure prediction models, the protein has a relatively high confidence score (pLDDT global: 88.13) , suggesting a well-defined tertiary structure. The protein has been identified in the genome of A. fulgidus, but its specific function remains to be fully elucidated. As part of an extremophile organism capable of growing at temperatures around 83°C and pressures up to 40-60 MPa , AF_2124 may possess thermostable and barostable properties that make it interesting for structural and functional studies.
Archaeoglobus fulgidus exhibits optimal growth at 83°C under various pressure conditions. For heterotrophic metabolism (lactate oxidation coupled to sulfate reduction), maximum growth rates are observed at 20 MPa, showing moderate piezophilic behavior. For autotrophic metabolism (CO₂ fixation coupled to thiosulfate reduction via H₂), growth rates remain nearly constant from 0.3 to 40 MPa, indicating piezotolerance . When cultivating A. fulgidus for protein extraction, these conditions should be considered:
| Metabolism Type | Optimal Temperature | Optimal Pressure | Growth Rate | Maximum Cell Density |
|---|---|---|---|---|
| Heterotrophic | 83°C | 20 MPa | Highest at 20 MPa | ~4.79 × 10⁸ cells/mL |
| Autotrophic | 83°C | 0.3-40 MPa (piezotolerant) | ~0.022-0.024 hr⁻¹ | ~9.22 × 10⁷ - 1.38 × 10⁸ cells/mL |
These conditions can be used for native protein expression before extraction for further characterization .
E. coli remains the preferred expression system for recombinant archaeal proteins due to its ease of genetic manipulation, rapid growth, and high protein yields. The T7 promoter system in pET vectors (medium copy number with pMB1 origin) is particularly effective for thermostable proteins from archaea, potentially yielding target protein representing up to 50% of total cell protein in successful cases .
For AF_2124 expression, consider these optimized parameters:
| Expression Element | Recommended Choice | Rationale |
|---|---|---|
| Host Strain | BL21(DE3) or C41(DE3)/C43(DE3) | Standard strain or Walker strains for potentially toxic proteins |
| Vector | pET series with T7 promoter | High-level expression under IPTG control |
| Induction | 0.1-0.5 mM IPTG at OD₆₀₀ 0.6-0.8 | Moderate induction to balance yield and solubility |
| Temperature | 16-20°C post-induction | Slower expression for proper folding |
| Supplements | 5-10% glycerol, metal ions if required | Enhanced protein solubility and stability |
For thermostable proteins like AF_2124, post-induction expression at lower temperatures can significantly improve protein solubility while maintaining the intrinsic stability of the native protein .
Codon optimization is critical when expressing archaeal proteins in bacterial systems due to differences in codon usage biases. For AF_2124, which comes from A. fulgidus with a high GC content and different codon preferences compared to E. coli, optimization should follow these methodological guidelines:
Analyze the codon adaptation index (CAI) of the native sequence
Replace rare codons with synonymous codons frequently used in the host organism
Avoid creating mRNA secondary structures or internal Shine-Dalgarno sequences
Maintain a balanced GC content throughout the sequence
Comparative expression studies have shown that codon optimization for archaeal genes can increase protein yield by 5-15 fold in E. coli systems. Additionally, optimizing the 5' region of the transcript is particularly important for translation initiation efficiency .
The structure of AF_2124 has been computationally modeled with high confidence (pLDDT global: 88.13) , indicating reliable prediction. Researchers can employ the following computational approaches for deeper structural and functional predictions:
Sequence-Based Methods:
Profile-sequence and profile-profile comparisons using HHpred
Conserved domain analysis through CDD, SMART, and Pfam
Evolutionary coupling analysis to identify co-evolving residues
Structure-Based Methods:
Structural alignment with characterized proteins using DALI or TM-align
Binding site prediction with CASTp, POCASA, or FTSite
Molecular dynamics simulations to evaluate stability at high temperatures and pressures
Integrative Approaches:
Combined sequence conservation and surface topology analysis
Genomic context analysis to identify functional associations
AlphaFold2-based predictions refined with molecular dynamics simulations
These methods can provide initial hypotheses about AF_2124 function that can guide experimental design for biochemical characterization .
Crystallizing proteins from hyperthermophilic archaea presents unique challenges but also advantages. For AF_2124, consider these methodological approaches:
Challenges and Solutions:
High salt requirements: Screen various salt types and concentrations (0.2-3.0 M)
Hydrophobic surface patches: Use amphiphilic additives like detergents (0.1-0.5% w/v)
Structural flexibility: Employ surface entropy reduction mutations
Oxidation-sensitive cysteines: Maintain reducing conditions with 1-5 mM DTT or TCEP
Thermostability Advantages:
Use higher crystallization temperatures (20-30°C) for more ordered crystal formation
Exploit intrinsic stability for longer crystallization trials
Test ligand or substrate co-crystallization to stabilize functional conformations
Recommended Screening Approach:
Initial broad screening at three temperatures (4°C, 20°C, 30°C)
Secondary optimization focusing on pH ranges 5.5-8.5
Micro-batch under oil and vapor diffusion methods in parallel
Addition of physiologically relevant ions (particularly zinc if it contains cysteine clusters like other A. fulgidus proteins)
Transcriptomic studies of A. fulgidus under stress conditions can provide valuable insights into the potential function of AF_2124. Based on whole-genome microarray studies of heat shock response in A. fulgidus, approximately 14% of open reading frames show altered transcript abundance under stress conditions .
To leverage transcriptomic data for AF_2124 characterization:
Expression Pattern Analysis:
Compare AF_2124 expression profiles under various stressors (heat, pressure, oxidative stress)
Identify co-expressed genes for potential functional relationships
Determine if AF_2124 is part of a stress response operon
Regulatory Element Identification:
Experimental Design Based on Transcriptomic Data:
Focus functional assays on conditions where AF_2124 is highly expressed
Consider knockout/complementation experiments based on co-expression networks
Investigate protein-protein interactions with co-expressed gene products
This approach connects genomic, transcriptomic, and functional data to build a comprehensive understanding of the protein's biological role .
Some A. fulgidus proteins, such as DNA polymerase D (Pol-D), contain critical zinc-binding cysteine clusters that are essential for function . To investigate if AF_2124 has similar structural features:
Sequence Analysis:
Identify conserved cysteine clusters in the AF_2124 sequence
Compare pattern to known zinc-binding motifs (C-X₂-C-X₂₄-C-X₂-C)
Perform multiple sequence alignment with characterized zinc-binding proteins
Experimental Metal Content Determination:
Inductively coupled plasma mass spectrometry (ICP-MS) of purified protein
Colorimetric zinc detection using 4-(2-pyridylazo)resorcinol (PAR)
Atomic absorption spectroscopy for quantitative metal analysis
Functional Validation:
Site-directed mutagenesis of predicted zinc-coordinating residues
Activity assays with and without zinc supplementation
Metal chelation studies using EDTA or 1,10-phenanthroline
Circular dichroism spectroscopy to assess structural changes upon metal binding/removal
If AF_2124 contains zinc-binding motifs, this could indicate roles in DNA binding, catalysis, or structural stability at high temperatures .
Comparative genomic analysis can reveal evolutionary relationships and potential functional conservation of AF_2124 across different archaeal species:
Phylogenetic Analysis:
Construct phylogenetic trees using maximum likelihood methods
Calculate evolutionary distances between homologs
Identify orthologous relationships across archaeal lineages
Conservation Patterns:
Analyze selective pressure using dN/dS ratios
Identify ultra-conserved residues as potential functional sites
Map conservation onto the predicted 3D structure
Genomic Context Conservation:
Compare gene neighborhoods across species
Identify conserved operonic structures
Analyze synteny between A. fulgidus and related species
The comparison with the genomic context of AF_2124 across the five Archaeoglobus species genomes available (including strain 7324 from North Sea oil fields) could reveal functional associations based on conserved gene neighborhoods .
Comparative genomics approaches can illuminate how AF_2124 might contribute to A. fulgidus' remarkable adaptability to high temperature and pressure environments:
Distribution Analysis:
Structural Adaptation Signatures:
Analyze amino acid composition biases associated with thermostability
Identify stabilizing interactions unique to extremophile homologs
Compare charged residue distribution on protein surfaces
Molecular Evolution Rates:
Calculate evolutionary rates in thermophiles versus mesophiles
Identify accelerated evolution in specific domains
Analyze positive selection signatures in extremophile lineages
The core genome analysis of Archaeoglobus species identified 1001 core genes, with AF_2124 potentially being part of the core or accessory genome that contributes to the specific adaptations of these hyperthermophiles .
To study AF_2124 under conditions that mimic its native deep-sea environment, researchers can employ high-hydrostatic pressure (HHP) cultivation techniques:
Methodological Approach:
Use static high-pressure vessels with specialized sampling systems
Employ glass syringes with minimal headspace for optimal pressure control
Implement proper decompression protocols (~19 MPa/min) to minimize stress responses
Experimental Design:
Compare AF_2124 expression levels across a pressure gradient (0.3 to 60 MPa)
Analyze protein modifications under different pressure conditions
Examine localization and interaction partners at optimal versus stress pressures
Analytical Techniques:
Quantitative proteomics to measure AF_2124 abundance across conditions
Protein extraction under pressure-maintaining conditions
In situ activity assays under maintained pressure
This approach would reflect the true physiological conditions experienced by A. fulgidus in deep marine environments (2-5 km below sea level, 20-50 MPa pressures) and could reveal pressure-dependent functions of AF_2124.
When characterizing novel proteins like AF_2124, researchers often encounter contradictory data that requires careful experimental design to resolve:
Sources of Contradictory Data:
Expression system artifacts versus native function
In vitro versus in vivo activity discrepancies
Computational predictions conflicting with experimental results
Robust Experimental Design Approach:
Statistical Analysis for Resolution:
Confirmation Strategies:
Test function in multiple heterologous systems
Complement deletion mutants with wild-type and mutant variants
Perform in vivo crosslinking to validate interaction partners
A completely randomized experimental design can help control for environmental variables when testing AF_2124 function across different conditions, ensuring that observed effects are genuinely related to the protein's activity .
Genomic context and co-expression networks provide powerful frameworks for designing targeted functional studies:
Genomic Context Analysis:
Identify operonic structures containing AF_2124
Analyze nearby regulatory elements and their response conditions
Examine conservation of gene neighborhoods across related species
Co-expression Data Integration:
Analyze transcriptomic data across various stress conditions
Build weighted gene co-expression networks
Identify transcriptional modules containing AF_2124
Functional Inference and Validation:
Design assays based on functions of co-expressed genes
Test interactions with predicted partner proteins
Investigate shared regulatory mechanisms with co-expressed genes
Experimental Design Based on Network Predictions:
Target conditions where the co-expression module is activated
Perform affinity purification coupled with mass spectrometry (AP-MS)
Validate protein-protein interactions using bimolecular fluorescence complementation
This systems biology approach can narrow down potential functions from thousands of possibilities to a manageable set of testable hypotheses, significantly accelerating the functional characterization process.
If sequence analysis suggests AF_2124 may have DNA-binding capabilities (similar to HSR1 from A. fulgidus ), these computational and experimental approaches can confirm this function:
Computational DNA-Binding Prediction:
Search for helix-turn-helix, zinc finger, or other DNA-binding motifs
Apply machine learning algorithms trained on known DNA-binding proteins
Perform electrostatic surface potential mapping to identify positive patches
Use molecular docking to predict DNA-protein interactions
Structural Comparison:
Compare with HSR1 (AF1298) which has a helix-turn-helix DNA binding motif
Analyze structural similarity to known DNA-binding domains from thermophiles
Identify conserved residues in potential DNA-recognition regions
Binding Site Prediction:
Locate clusters of conserved basic residues on the protein surface
Predict binding energy landscapes for DNA-protein interactions
Model conformational changes upon DNA binding
This integrated computational approach can generate testable hypotheses about specific DNA sequences that might interact with AF_2124, similar to the CTAAC-N5-GTTAG motif recognized by HSR1 .
Designing comprehensive screening approaches for identifying the function of uncharacterized proteins requires multiple complementary strategies:
Activity-Based Screening:
Design a substrate library based on metabolic pathways in A. fulgidus
Screen for enzymatic activities (hydrolase, transferase, oxidoreductase)
Monitor cofactor consumption (ATP, NAD(P)H, etc.) in potential reactions
Use untargeted metabolomics to identify reaction products
Protein Interaction Screening:
Construct a genomic library of A. fulgidus proteins for two-hybrid screening
Perform protein microarray analysis with purified AF_2124
Use pull-down assays coupled with mass spectrometry
Employ proximity labeling in heterologous systems
Nucleic Acid Binding Screening:
Design SELEX (Systematic Evolution of Ligands by Exponential Enrichment) experiments
Perform genomic SELEX to identify native DNA/RNA targets
Use electrophoretic mobility shift assays with genomic fragments
Conduct ChIP-seq in heterologous systems expressing AF_2124
These comprehensive screening approaches can systematically test thousands of potential functions to identify the biological role of AF_2124.
Characterizing the stability of proteins from extremophiles requires specialized techniques that can operate under extreme conditions:
Thermal Stability Assessment:
Differential Scanning Calorimetry (DSC) with extended temperature range (up to 120°C)
Circular Dichroism (CD) spectroscopy with high-temperature cells
Intrinsic fluorescence monitoring during thermal denaturation
Activity retention assays after thermal challenge
Pressure Stability Techniques:
High-pressure spectroscopy using specialized pressure cells
Pressure perturbation calorimetry
Activity measurements under various pressures using custom pressure vessels
FTIR spectroscopy under pressure to monitor secondary structure
Combined Pressure-Temperature Stability:
Phase diagrams construction using multiple biophysical techniques
Determination of optimal and limiting conditions for structural integrity
Identification of pressure-temperature compensation effects
Data Analysis and Interpretation:
Fitting to appropriate thermodynamic models
Calculation of activation energies for unfolding
Determination of volume changes during pressure denaturation
These specialized approaches reveal how proteins like AF_2124 maintain structural integrity under the extreme conditions where A. fulgidus thrives (temperatures around 83°C and pressures up to 40-60 MPa) .
Site-directed mutagenesis represents a powerful approach to understanding the molecular basis of thermostability in proteins like AF_2124:
Target Selection Strategy:
Focus on charged residues in surface loops
Target proline residues in turn regions
Examine ion pair networks and salt bridges
Investigate hydrophobic packing in the protein core
Analyze unique amino acid compositions (increased Glu, Lys, reduced Gln, Asn)
Systematic Mutagenesis Approach:
Create alanine scanning libraries of selected regions
Engineer charge reversal mutations in ion pair networks
Introduce destabilizing mutations found in mesophilic homologs
Create chimeric proteins with mesophilic counterparts
Stability Analysis Pipeline:
Thermal denaturation monitoring by CD spectroscopy
Differential scanning fluorimetry (Thermofluor) for high-throughput screening
Activity retention after thermal challenge
Structural analysis of successful stabilizing mutations