Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2183 (AF_2183)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
AF_2183; Uncharacterized protein AF_2183
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2183
Target Protein Sequence
MTLLSINYEKFKYIEVPELLSKLGVVFMRGYVVGLVLALMLVTAPAMAEDFSMNGTEFAA AFIKNTVSNLDLGAKFLHLLYEVNDTDTNSNLFQNLWGLVYGGVLVAGWNNQVTAEVLET LADSDNLTSQRTNISESIRMMATNTSVVFGDTEGSQGLAALMKYQVKALQNTSITTTNST GVEVPLVEAYAEALANTITDNVKFMMELFKAIPNALT
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2183

STRING: 224325.AF2183

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus Uncharacterized protein AF_2183?

AF_2183 is a protein of unknown function derived from the hyperthermophilic archaeon Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126). It is cataloged in the UniProt database under the accession number O28100 . As an uncharacterized protein, AF_2183 represents one of many proteins in microbial genomes whose biological roles, biochemical functions, and structural properties remain to be elucidated. The recombinant form is typically produced as either a full-length (217 amino acids) or partial protein with various expression tags to facilitate purification and experimental manipulation .

What expression systems are commonly used to produce recombinant AF_2183?

Two primary expression systems are documented for recombinant AF_2183 production:

  • Bacterial expression (E. coli): Commonly used for full-length protein production with His-tag modification .

  • Mammalian cell expression: Used for producing partial protein constructs with potentially different post-translational modifications .

The choice of expression system depends on experimental requirements:

Expression SystemAdvantagesLimitationsTypical Applications
E. coliHigh yield, cost-effective, full-length proteinPotential folding issues for archaeal proteins, lack of post-translational modificationsStructural studies, antibody production, basic biochemical assays
Mammalian cellsBetter folding for complex proteins, post-translational modificationsLower yield, higher costFunctional studies requiring native-like modifications, interaction studies

For optimal results, researchers should consider protein solubility, required modifications, and downstream applications when selecting an expression system .

How should recombinant AF_2183 be stored for maximum stability?

Proper storage is critical for maintaining protein stability and activity. For recombinant AF_2183, manufacturers recommend:

  • Short-term storage (up to one week): 4°C in appropriate buffer systems

  • Medium-term storage (up to 6 months): -20°C or -80°C for liquid formulations

  • Long-term storage (up to 12 months): -20°C or -80°C for lyophilized formulations

To optimize stability:

  • Add glycerol to a final concentration of 5-50% (typically 50%) for cryoprotection

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles

  • Use a quick-freeze method (e.g., liquid nitrogen) before transferring to long-term storage

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL concentration

The shelf life varies based on storage conditions, buffer composition, and the intrinsic stability of the protein preparation .

What experimental design approaches are most effective for determining the function of uncharacterized proteins like AF_2183?

Effective experimental design for functional characterization of uncharacterized proteins like AF_2183 requires a systematic approach using both in silico prediction and laboratory validation:

  • Computational prediction phase:

    • Conduct sequence homology analysis to identify potential functional domains

    • Generate co-regulation maps with known proteins (as demonstrated in the proteomeHD approach)

    • Analyze genomic context and gene clustering patterns

  • Experimental validation phase:

    • Design a true experimental research design with:

      • Clearly defined independent variables (e.g., environmental conditions, substrate presence)

      • Specific dependent variables (e.g., catalytic activity, binding affinity)

      • Proper controls to account for extraneous variables

    • Implement randomization and replication to ensure statistical reliability

A particularly effective approach is to use co-regulation data, which has successfully revealed functional relationships between proteins that don't physically interact or co-localize. For example, researchers identified an organelle interface between peroxisomes and mitochondria by analyzing co-regulation patterns of the PEX11β protein with mitochondrial respiration factors .

Example experimental design framework for AF_2183:

PhaseApproachVariables to ConsiderExpected Outcomes
PredictionBioinformatic analysisSequence conservation, domain architecture, genomic contextPotential functional categories
ScreeningActivity assaysBuffer conditions, potential substrates, temperature, pHPreliminary functional data
ValidationTargeted biochemical assaysSubstrate concentration, enzyme concentration, reaction timeKinetic parameters, specificity
Structural analysisCrystallography or NMRProtein concentration, buffer conditions, crystallization agentsStructure-function relationships

The key is to design experiments that test specific hypotheses about protein function while controlling for confounding variables that might affect the results .

How can protein co-regulation mapping be applied to predict the function of AF_2183?

Protein co-regulation mapping offers a powerful approach for functional prediction of uncharacterized proteins. This methodology examines how protein abundance changes across multiple biological perturbations to reveal functional relationships:

  • Data collection phase:

    • Conduct quantitative proteomics across multiple conditions (minimum of 200+ perturbations for statistical power)

    • Measure changes in abundance of target protein (AF_2183) alongside thousands of other proteins

    • Apply isotope-labeling mass spectrometry for precise quantification

  • Analysis phase:

    • Apply machine learning algorithms (e.g., treeClust) to identify proteins with similar abundance patterns

    • Generate co-regulation networks that connect functionally related proteins

    • Identify protein clusters that suggest shared biological processes

Implementation example from the Nature Biotechnology study:

  • Researchers compiled abundance changes of 10,323 human proteins across 294 biological perturbations

  • The resulting co-regulation map revealed functional associations between proteins

  • This approach successfully identified functions of proteins that don't physically interact or co-localize

For AF_2183 specifically, researchers could:

  • Express recombinant AF_2183 in a model organism

  • Subject cells to various stresses (temperature, pH, nutrient limitation, etc.)

  • Monitor abundance changes via proteomics

  • Identify known proteins with similar regulation patterns

  • Infer potential functions based on these established protein networks

This approach is particularly valuable because it captures functional relationships that might be missed by traditional protein-protein interaction studies, offering deeper insights into potential roles of uncharacterized proteins .

What control variables should be considered when studying archaeal proteins like AF_2183?

When designing experiments with archaeal proteins like AF_2183 from Archaeoglobus fulgidus, researchers must carefully control several variables to ensure valid and reproducible results:

  • Temperature conditions:

    • A. fulgidus is hyperthermophilic with optimal growth at 83°C

    • Test protein activity across a temperature range (60-95°C)

    • Include appropriate controls at each temperature point

    • Ensure temperature stability during assays

  • Buffer composition:

    • pH stability (typically pH 6.0-7.5 for A. fulgidus proteins)

    • Salt concentration (high ionic strength often required)

    • Presence of reducing agents to maintain sulfhydryl groups

    • Stabilizing additives (glycerol, specific ions)

  • Experimental design considerations:

    • Include both positive controls (known archaeal enzymes) and negative controls

    • Account for potential contaminating activities from expression host

    • Design randomized trials to minimize systematic bias

    • Implement blinding where appropriate for observational measurements

  • Specialized methodological controls:

    • Expression system artifacts (compare E. coli vs. mammalian expression)

    • Tag interference (compare different tag positions or tag-free protein)

    • Buffer components that might affect activity

    • Storage conditions and freeze-thaw effects

A properly controlled experimental design should incorporate a true experimental research approach with randomization of subjects to treatment groups and systematic manipulation of independent variables while controlling for extraneous factors . For archaeal proteins specifically, temperature and buffer stability are critical control variables that can significantly impact experimental outcomes.

What bioinformatic approaches can help predict potential functions of AF_2183?

Advanced bioinformatic strategies can provide crucial insights into the potential functions of uncharacterized proteins like AF_2183. A comprehensive approach should include:

  • Sequence-based analysis:

    • Position-Specific Iterative BLAST (PSI-BLAST) to detect remote homologs

    • Hidden Markov Model (HMM) profiling against domain databases

    • Identification of conserved motifs and functional residues

    • Multiple sequence alignment with diverse archaeal proteins

  • Structural prediction and analysis:

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Structural comparison with characterized proteins (DALI, FATCAT)

    • Active site prediction and molecular docking simulations

    • Molecular dynamics to assess flexibility and potential binding sites

  • Genomic context analysis:

    • Examination of neighboring genes in A. fulgidus genome

    • Comparative genomics across related species

    • Analysis of gene clustering patterns

    • Identification of conserved operons or gene neighborhoods

  • Functional association networks:

    • Integration with protein co-regulation data

    • Exploration of co-occurrence patterns across species

    • Incorporation of empirical protein-protein interaction data

    • Pathway enrichment analysis of predicted interaction partners

Learning from precedent: The functional elucidation of a DUF1680 protein family member ultimately defined a new glycoside hydrolase family (GH127) . This suggests that careful bioinformatic analysis combined with targeted biochemical assays can lead to significant functional insights, even for previously uncharacterized protein families.

Applying these approaches to AF_2183 could reveal potential biochemical functions, cellular roles, and evolutionary relationships that would guide subsequent experimental validation.

How can experimental contradictions in AF_2183 research be systematically resolved?

Resolving contradictory findings is a critical aspect of research on uncharacterized proteins like AF_2183. A systematic approach includes:

  • Context analysis and categorization:
    Research has identified five main categories of contextual characteristics that explain apparent contradictions in biomedical literature :

    • Internal to the subject (species differences, genetic variation)

    • External to the subject (experimental conditions, reagents)

    • Endogenous/exogenous factors

    • Known controversies in the field

    • Actual contradictions in literature

  • Systematic resolution methodology:

    • Identification phase: Collect all relevant claims about AF_2183

    • Normalization phase: Standardize terminology and experimental parameters

    • Comparison phase: Analyze experimental conditions, methods, and controls

    • Resolution phase: Design controlled experiments to test competing claims

  • Common sources of contradictions:

    • Underspecified experimental context (temperature, pH, buffer composition)

    • Species or strain variations within Archaeoglobus fulgidus

    • Differences in protein preparation (full-length vs. partial, tag effects)

    • Methodological variations (detection sensitivity, assay conditions)

  • Resolution strategies:

    • Side-by-side testing of competing protocols

    • Collaborative cross-validation between laboratories

    • Standardization of experimental conditions

    • Meta-analysis of all available data with context variables

A structured approach using appropriate experimental design with randomization, proper controls, and systematic manipulation of variables is essential for resolving contradictions . When designing resolution experiments, researchers should explicitly address the contextual factors identified in comparative literature analysis to ensure that the true sources of variation are captured.

What specialized techniques are required for functional characterization of archaeal proteins compared to bacterial or eukaryotic proteins?

Archaeal proteins like AF_2183 present unique challenges that require specialized approaches for functional characterization:

  • Extremophile-adapted techniques:

    • High-temperature enzyme assays (60-95°C)

    • Specialized equipment (heated reaction chambers, thermostable reagents)

    • Buffer systems optimized for thermostability

    • Oxygen-free conditions for anaerobic archaeal proteins

  • Structural biology considerations:

    • Crystallization at higher temperatures

    • Modified purification protocols to maintain native folding

    • Specialized NMR techniques for thermostable proteins

    • Cryo-EM sample preparation adaptations

  • Expression and purification strategies:

    • Codon optimization for heterologous expression

    • Use of archaeal expression hosts for difficult proteins

    • Heat-treatment steps to remove host proteins

    • Specialized affinity tags that function at high temperatures

  • Functional assay modifications:

    • Temperature-resistant substrate analogs

    • Modified spectroscopic techniques for high-temperature reactions

    • Rapid sampling and quenching methods

    • Activity normalization across temperature ranges

  • Comparative approaches:

    • Parallel analysis with bacterial homologs when available

    • Domain swapping experiments to identify thermostable regions

    • Directed evolution to identify functional residues

    • Ancestral sequence reconstruction and analysis

Case study insight: The successful characterization of HypBA1, a previously uncharacterized DUF1680 family member, as a β-L-arabinofuranosidase that defines a new glycoside hydrolase family (GH127) demonstrates how targeted biochemical approaches can illuminate the function of uncharacterized proteins . Similar methodologies could be applied to AF_2183, with appropriate modifications for archaeal protein biochemistry.

How should I integrate multiple data types to develop a unified model of AF_2183 function?

Developing a comprehensive understanding of an uncharacterized protein like AF_2183 requires integration of diverse data types through a multi-layered analytical approach:

  • Data integration framework:

    • Layer 1: Sequence and structure information

    • Layer 2: Biochemical and biophysical properties

    • Layer 3: Interaction and co-regulation patterns

    • Layer 4: Cellular and organismal effects

  • Integration methodologies:

    • Hierarchical integration: Building models that incorporate increasingly complex data

    • Network-based approaches: Creating functional association networks from multiple data sources

    • Machine learning: Training algorithms on multiple data types to predict function

    • Bayesian integration: Assigning confidence scores to functional predictions based on evidence types

  • Practical implementation steps:

    • Begin with sequence analysis and homology modeling

    • Add experimental biochemical data as constraints

    • Incorporate protein interaction data from co-immunoprecipitation or yeast two-hybrid studies

    • Layer co-regulation data from proteomics studies

    • Validate with targeted gene knockout or protein inhibition studies

  • Visualization and analysis tools:

    • Cytoscape for network visualization and analysis

    • R or Python for statistical integration of multiple datasets

    • Specialized tools like STRING for protein-protein interaction network building

    • Co-regulation visualization platforms like www.proteomeHD.net[3]

This integrated approach mirrors successful strategies used to characterize other proteins of unknown function, such as the functional elucidation of a DUF1680 protein family member as a β-L-arabinofuranosidase, which ultimately defined a new glycoside hydrolase family (GH127) . By systematically combining diverse data types, researchers can develop testable hypotheses about AF_2183 function that are grounded in multiple lines of evidence.

What are best practices for reporting experimental findings on uncharacterized proteins like AF_2183?

Comprehensive reporting of research on uncharacterized proteins requires attention to detail and transparency:

  • Complete methodological documentation:

    • Precise description of the recombinant protein (full length vs. partial, tag type and position)

    • Complete expression system details (host strain, vector, induction conditions)

    • Detailed purification protocols with buffer compositions

    • Storage conditions and handling procedures

    • Exact experimental conditions (temperature, pH, reagent concentrations)

  • Experimental design reporting:

    • Clear statement of research questions and hypotheses

    • Detailed description of independent and dependent variables

    • Explanation of how extraneous variables were controlled

    • Randomization and blinding procedures when applicable

    • Sample size calculation and statistical power analysis

  • Result presentation standards:

    • Raw data availability in appropriate repositories

    • Clear separation of observed results from interpretation

    • Comprehensive negative results reporting

    • Statistical analysis with appropriate tests and significance levels

    • Visual representation of data with error bars and replicate information

  • Addressing potential contradictions:

    • Explicit comparison with existing literature

    • Discussion of methodological differences that might explain discrepancies

    • Analysis of contextual factors that might affect results

    • Suggestions for standardization to resolve contradictions

  • Speculative interpretation guidelines:

    • Clear labeling of speculative functional assignments

    • Multiple lines of evidence to support functional hypotheses

    • Discussion of alternative interpretations

    • Proposed experiments to further validate functional assignments

Following these best practices ensures that research on AF_2183 contributes meaningfully to the scientific understanding of this protein and facilitates further research by other groups, ultimately accelerating the functional characterization of uncharacterized proteins.

How can I design a progressive research program to fully characterize AF_2183?

A comprehensive research program for the characterization of AF_2183 should follow a strategic progression from basic characterization to advanced functional studies:

  • Phase I: Foundational Characterization (0-6 months)

    • Bioinformatic analysis of sequence and predicted structure

    • Optimization of expression and purification protocols

    • Basic biochemical characterization (stability, oligomeric state)

    • Preliminary functional screening (enzymatic activity assays)

  • Phase II: Functional Hypothesis Development (6-12 months)

    • Co-regulation mapping with known proteins

    • Protein-protein interaction studies

    • Structural determination (X-ray crystallography or cryo-EM)

    • In silico docking with potential substrates

  • Phase III: Hypothesis Testing (12-18 months)

    • Targeted biochemical assays based on predictions

    • Site-directed mutagenesis of predicted functional residues

    • Development of activity assays specific to hypothesized function

    • Expression in heterologous systems for in vivo functional studies

  • Phase IV: Comprehensive Characterization (18-24 months)

    • Determination of reaction mechanism (if enzymatic)

    • Characterization of biological role in A. fulgidus

    • Comparative analysis with homologs from other species

    • Integration of all data into a unified functional model

  • Phase V: Application Development (24+ months)

    • Exploration of potential biotechnological applications

    • Engineering studies to enhance desired properties

    • Development of inhibitors or activators (if relevant)

    • Comparative genomics to identify related uncharacterized proteins

Key experimental design considerations include:

  • Implementation of true experimental designs with appropriate controls

  • Careful selection of independent and dependent variables for each study

  • Systematic approach to address potential contradictions in results

  • Integration of multiple data types for robust functional prediction

This phased approach ensures a systematic progression that builds upon each discovery while maintaining flexibility to pursue promising leads as they emerge from the data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.