Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2191

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (UniProt ID: O28092) is a full-length, His-tagged recombinant protein derived from the hyperthermophilic archaeon Archaeoglobus fulgidus. This protein remains functionally uncharacterized despite being part of a genomic fraction encoding conserved but poorly understood proteins in sulfur-metabolizing archaea . Commercially available recombinant versions are expressed in Escherichia coli and purified for research applications, including structural studies and biochemical assays .

Research Applications and Functional Insights

While AF_2191’s biological role remains elusive, its recombinant form supports diverse experimental approaches:

  • ELISA Development: Used as an antigen in ELISA kits for detecting antibodies or binding partners .

  • Pathway Inference: Genomic studies suggest potential involvement in conserved archaeal pathways, though specific interactions or functions are unverified .

  • Structural Studies: Computed models (e.g., AF-O28092-F1) enable hypothesis-driven investigations of binding sites or conformational dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_2191; Uncharacterized protein AF_2191
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2191
Target Protein Sequence
MLYGRIFFNSGVQLLSMADKKFSLIALVSFTALAIIVLYHNISPYLTPSDLIAQGKAENV QVVGKIVSVNGNTFQLSDGKNTITAVYNGTVQRYDAEVVVVGNWDGKVLHATKVLQKCHT EYKGG
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2191

STRING: 224325.AF2191

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus Uncharacterized protein AF_2191?

AF_2191 is an uncharacterized protein from the hyperthermophilic archaeon Archaeoglobus fulgidus, consisting of 125 amino acids. It falls into the category of "orphan proteins" - proteins with no known function or characterized homologs. The protein is available as a recombinant product expressed in E. coli with a His-tag . Based on structural studies of related archaeal proteins, it likely possesses a unique fold that may contribute to its function in extremophilic environments. Understanding AF_2191 is particularly important for expanding our knowledge of archaeal biology and potentially discovering novel protein functions adapted to extreme conditions.

What structural information is available for AF_2191?

While direct structural information specifically for AF_2191 is limited, insights can be drawn from related archaeal proteins. For instance, the AF2331 protein from Archaeoglobus fulgidus forms an unusual interdigitated dimer with a novel α+β fold . This structure consists of two core β-sheets that are interdigitated, containing strands alternating from both subunits. The dimerization results in an unusually large decrease in solvent-accessible surface area (3960 Ų) for a protein of its size, with approximately 41.1% of the total surface area buried in the interface . If AF_2191 shares structural characteristics with AF2331, it may possess similar oligomerization properties that are critical to its function. Researchers should consider both X-ray crystallography and cryo-electron microscopy approaches to definitively resolve the structure.

How should researchers approach the functional characterization of AF_2191?

Functional characterization of uncharacterized proteins like AF_2191 requires a multi-faceted approach that integrates both computational and experimental methods. Begin with bioinformatic analyses including sequence alignments, motif identification, and structural predictions to generate initial hypotheses about potential functions. Follow with experimental validation through:

  • Expression profiling under different environmental conditions

  • Protein-protein interaction studies using pull-down assays or yeast two-hybrid screening

  • Biochemical assays testing for enzymatic activities based on structural predictions

  • Gene knockout or knockdown studies to observe phenotypic changes

For thermophilic proteins like AF_2191, ensure all functional assays are conducted at physiologically relevant temperatures for Archaeoglobus fulgidus (optimal growth at ~83°C). Careful experimental design is essential, with appropriate controls to account for the unique biochemical properties of archaeal proteins .

What are the key considerations for experimental design when studying AF_2191?

When designing experiments to study AF_2191, researchers must carefully define variables and develop specific, testable hypotheses . For AF_2191, consider the following experimental design framework:

Research ComponentSpecific Consideration for AF_2191
Independent variableExperimental conditions (temperature, pH, salt concentration)
Dependent variableMeasurable outcomes (protein activity, binding affinity, structural changes)
Control variablesBuffer composition, protein concentration, incubation time
Experimental groupsWild-type AF_2191, mutant variants, related archaeal proteins
Sample sizeDetermined by power analysis based on expected effect size

Additionally, since AF_2191 is from a hyperthermophilic archaeon, experiments must account for its thermostability and potential requirement for extreme conditions. Include both positive controls (proteins with known function under similar conditions) and negative controls (buffer-only or unrelated protein samples) to validate your experimental approach . This systematic approach will help generate reliable data on this previously uncharacterized protein.

What expression systems are optimal for recombinant AF_2191 production?

  • E. coli-based systems: Advantages include high yield and established protocols. Use specialized strains like Rosetta or Arctic Express for improved folding of archaeal proteins. Optimal growth temperature should be 37°C with induction at lower temperatures (16-20°C) to enhance proper folding.

  • Archaeal expression hosts: For authentic post-translational modifications and proper folding, consider Sulfolobus systems, which provide a more native-like environment for archaeal proteins.

  • Cell-free expression systems: These can be advantageous for potentially toxic proteins or when rapid production is needed for structural studies.

Each expression system requires optimization of key parameters:

  • Induction conditions (temperature, inducer concentration, timing)

  • Growth media composition (especially mineral supplementation)

  • Cell lysis methods (sonication vs. chemical lysis)

  • Purification strategy (affinity chromatography followed by size exclusion)

The recombinant protein should be validated through Western blotting, mass spectrometry, and activity assays to confirm proper expression and folding.

How can researchers design experiments to resolve contradictory findings about AF_2191?

Resolving contradictions in the literature regarding AF_2191 requires a systematic approach that addresses potential sources of variability. When contradictory findings appear, implement these methodological steps:

  • Context analysis: Extract specific claims from the literature and identify potential contextual factors that might explain discrepancies . For AF_2191, this might include differences in expression systems, purification methods, or assay conditions.

  • Parameter standardization: Design experiments that systematically vary one parameter at a time while keeping others constant. Create a data table format similar to what-if analysis tools to evaluate how different conditions affect outcomes . For example:

Temperature (°C)pHSalt Concentration (mM)Activity LevelReference
757.0100[Result 1]Study A
857.0100[Result 2]Study B
756.0100[Result 3]Your Study
  • Replication with detailed methods: Attempt to replicate contradictory findings by following published protocols precisely, then systematically varying conditions to identify critical factors affecting results.

  • Meta-analysis approach: Analyze all available data collectively to determine if contradictions might be explained by statistical variation rather than true biological differences .

By implementing this structured approach, researchers can identify whether contradictions in AF_2191 research stem from methodological differences, biological variability, or data interpretation.

What statistical approaches are most appropriate for analyzing AF_2191 interaction data?

When analyzing protein interaction data for AF_2191, researchers should employ statistical methods that account for the unique characteristics of interaction experiments. The appropriate statistical approach depends on the specific experimental design and data type:

  • For binary interaction data (e.g., yeast two-hybrid results):

    • Fisher's exact test to determine significance of observed interactions

    • False discovery rate correction for multiple comparisons

    • Bayesian statistical frameworks to integrate prior knowledge about archaeal protein networks

  • For quantitative interaction data (e.g., pull-down or co-immunoprecipitation):

    • ANOVA with post-hoc tests for comparing multiple conditions

    • Consider non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated

    • Correlation analysis to identify relationship patterns between experimental variables

  • For high-throughput interaction studies:

    • Network analysis techniques to identify significant interaction clusters

    • Enrichment analysis to determine biological processes overrepresented in the interactome

    • Dimensionality reduction methods (PCA, t-SNE) to visualize complex interaction landscapes

When presenting statistical results, include both p-values and effect sizes to provide a complete picture of the data's biological significance, not just statistical significance. Data tables should display both raw and normalized data to allow for transparent interpretation .

How can researchers use data tables to effectively analyze experimental results for AF_2191?

Data tables provide a powerful framework for analyzing and presenting experimental results for AF_2191 studies. To maximize their utility:

  • Structure your data tables as what-if analysis tools that allow you to explore multiple variables simultaneously, similar to Excel's data table functionality . For example, create tables that examine how different experimental conditions affect protein activity:

Temperature (°C)50 mM NaCl100 mM NaCl200 mM NaCl500 mM NaCl
65Activity 1Activity 2Activity 3Activity 4
75Activity 5Activity 6Activity 7Activity 8
85Activity 9Activity 10Activity 11Activity 12
95Activity 13Activity 14Activity 15Activity 16
  • Implement hierarchical data organization to represent relationships between experimental variables. For AF_2191, this might include:

    • Primary grouping by experimental condition

    • Secondary grouping by protein variant

    • Tertiary grouping by measurement timepoint

  • Use conditional formatting to highlight patterns and outliers in your data, making it easier to identify conditions where AF_2191 behaves unexpectedly.

  • Incorporate statistical summaries within your tables, including means, standard deviations, and p-values for comparisons between conditions.

This structured approach to data organization facilitates both exploratory analysis and hypothesis testing, allowing researchers to identify subtle patterns in AF_2191 behavior across different experimental conditions .

What current hypotheses exist regarding the function of AF_2191 in Archaeoglobus fulgidus?

Several hypotheses have emerged regarding the potential function of AF_2191, based on limited structural and contextual information:

  • Protein-protein interaction mediator: The presence of negatively charged surface clusters on related archaeal proteins suggests that AF_2191 may interact with basic proteins . For example, since AF2331 (another archaeal protein) is located on the same operon as the basic protein AF2330, it has been hypothesized that they form a charge-stabilized complex in vivo . Similarly, AF_2191 may partner with positively charged proteins to perform its biological function.

  • Adaptation to extreme environments: As a protein from a hyperthermophilic archaeon, AF_2191 may play a role in maintaining cellular integrity under extreme conditions. The unusual dimerization observed in similar archaeal proteins could contribute to increased stability at high temperatures and pressures.

  • Novel enzymatic activity: The unique structural features of archaeal proteins like AF_2191 might enable novel catalytic functions that are not predicted by sequence homology alone. Experimental screens for various enzymatic activities are warranted.

  • Regulatory role in gene expression: The small size and potential for protein-protein interactions suggest AF_2191 might function in transcriptional or translational regulation specific to archaeal systems.

These hypotheses require systematic experimental testing, beginning with protein interaction studies and progressing to functional assays in both heterologous systems and, ideally, within Archaeoglobus fulgidus itself.

How might computational approaches assist in predicting the function of AF_2191?

Advanced computational approaches offer powerful tools for predicting the function of uncharacterized proteins like AF_2191 when experimental data is limited:

  • Protein structure prediction using AI-based models: Recent advances in deep learning approaches like AlphaFold2 can predict protein structures with remarkable accuracy, even for proteins with limited sequence homology to characterized proteins. For AF_2191, generating a predicted structure can reveal potential binding pockets or catalytic sites not evident from sequence analysis alone.

  • Molecular dynamics simulations: For thermophilic proteins like AF_2191, simulations at elevated temperatures can reveal conformational flexibility and stability determinants. Key analyses should include:

    • Root mean square deviation (RMSD) across temperature ranges

    • Identification of stabilizing salt bridges and hydrophobic interactions

    • Solvent accessibility changes under different conditions

  • Genomic context analysis: Examining the operonic structure and genomic neighborhood of the AF_2191 gene can provide functional insights. Proteins encoded in the same operon often function in related pathways or form complexes.

  • Cross-species comparison: While AF_2191 may lack obvious homologs, subtle sequence patterns might be detected through position-specific scoring matrices or hidden Markov models across diverse archaeal species.

  • Protein-protein interaction prediction: Tools like STRING or InterPreTS can predict potential interaction partners based on co-expression, genomic proximity, and structural compatibility.

The integration of these computational approaches with targeted experimental validation represents the most promising strategy for elucidating the function of this enigmatic protein.

What challenges exist in studying thermostable proteins like AF_2191, and how can they be addressed?

Studying thermostable proteins from hyperthermophilic archaea like Archaeoglobus fulgidus presents several unique challenges that require specialized approaches:

  • Expression and folding challenges:

    • Challenge: Archaeal proteins often misfold or form inclusion bodies when expressed in mesophilic hosts like E. coli.

    • Solution: Utilize lower induction temperatures (16-20°C), specialized chaperone co-expression systems, or archaeal expression hosts like Sulfolobus species. For AF_2191, E. coli expression has been successful with His-tagging , but optimization may be required for full activity.

  • Activity assay conditions:

    • Challenge: Standard enzyme assays may not reflect the true activity of thermophilic proteins when conducted at standard laboratory temperatures.

    • Solution: Design experimental protocols that include high-temperature incubation steps and thermostable reagents. Consider using sealed, pressurized reaction vessels for studies above 80°C to prevent evaporation.

  • Structural analysis difficulties:

    • Challenge: Crystallization conditions optimized for mesophilic proteins may not be suitable for thermophilic proteins.

    • Solution: Screen crystallization conditions at elevated temperatures and consider alternative structural determination methods like cryo-EM.

  • Stability vs. activity paradox:

    • Challenge: Conditions that maintain the stability of thermophilic proteins (high temperature, high salt) may interfere with interaction studies or activity assays.

    • Solution: Develop a systematic experimental design that tests a matrix of conditions, varying temperature, salt concentration, and pH to identify optimal conditions for both stability and activity .

  • Limited genetic tools:

    • Challenge: Genetic manipulation of Archaeoglobus fulgidus is challenging, limiting in vivo functional studies.

    • Solution: Develop archaeal genetic systems or consider heterologous expression in genetically tractable archaeal models like Thermococcus kodakarensis.

By addressing these challenges with specialized techniques, researchers can overcome the unique difficulties associated with studying thermostable proteins like AF_2191.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.