Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2239 (AF_2239)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2239 (AF_2239)

Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2239 (AF_2239) is a protein derived from the archaeon Archaeoglobus fulgidus. A. fulgidus is a hyperthermophilic microorganism, meaning it thrives in extremely high-temperature environments, typically between 60 and 95°C . This particular protein, AF_2239, is referred to as "uncharacterized" because its specific function within the organism is not yet fully understood .

Basic Information

FeatureDescription
NameRecombinant Full Length Archaeoglobus fulgidus Uncharacterized Protein AF_2239 (AF_2239) Protein, His-Tagged
SpeciesArchaeoglobus fulgidus
SourceE. coli
TagHis
Protein LengthFull Length (1-356 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
UniProt IDO28044
SynonymsAF_2239; Uncharacterized protein AF_2239
Amino Acid SequenceMRYAIFDESNLERVLKAIGEASPEFRRFRYVELLAKSEKGVVGKYRSLYFLFSKEPFELDVEPIEIFEVEIEKDDGNFRSFRFGKYSLRDKLLLDCNFNEKLFYDYLPALLCEISSARLLIKDCNLRASHLAERESEIVKEITKISEDVKTLSIEKLEELSFEVSALRASFFSSYMLFKDDVEEIFSSIARASSISNFLGGLLKEQIDELRNQLETISYFESRFEQTLSGVRDALDVVHLRLEMLRGKENLELQKRTSALQAAAAVIEFVAVFYYSMKIWEAFLPVTEMPHWLSFSLLAAFTFTVVVYTEALGDYIRERKPSSKLVLLTLTLAILVILMATLPTLFSAASQLSGGH

Production and Characteristics

The recombinant form of AF_2239 is produced in Escherichia coli (E. coli) and includes a histidine tag (His-tag) for purification purposes . The protein consists of 356 amino acids and is provided as a lyophilized powder . SDS-PAGE analysis indicates a purity level exceeding 90% .

Potential Functions and Interactions

AF_2239 is predicted to participate in various biochemical pathways and molecular functions . It may interact with other proteins, as detected through methods such as yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AF_2239; Uncharacterized protein AF_2239
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2239
Target Protein Sequence
MRYAIFDESNLERVLKAIGEASPEFRRFRYVELLAKSEKGVVGKYRSLYFLFSKEPFELD VEPIEIFEVEIEKDDGNFRSFRFGKYSLRDKLLLDCNFNEKLFYDYLPALLCEISSARLL IKDCNLRASHLAERESEIVKEITKISEDVKTLSIEKLEELSFEVSALRASFFSSYMLFKD DVEEIFSSIARASSISNFLGGLLKEQIDELRNQLETISYFESRFEQTLSGVRDALDVVHL RLEMLRGKENLELQKRTSALQAAAAVIEFVAVFYYSMKIWEAFLPVTEMPHWLSFSLLAA FTFTVVVYTEALGDYIRERKPSSKLVLLTLTLAILVILMATLPTLFSAASQLSGGH
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2239

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant in research?

Archaeoglobus fulgidus is a hyperthermophilic euryarchaeon that grows optimally at 83°C under strict anaerobic conditions . This organism has garnered significant scientific interest due to its ability to thrive in extreme environments and its evolutionary position within the Archaea domain. A. fulgidus serves as an excellent model organism for studying adaptations to hyperthermophilic conditions, particularly mechanisms that protect against DNA damage that would typically accelerate at high temperatures. The organism's mechanisms for DNA repair, including base excision repair (BER) pathways, are particularly notable as they differ from those found in most eukaryotes and bacteria . Studying proteins from this organism provides insights into evolutionary adaptations to extreme conditions and potentially novel enzymatic activities that function at high temperatures.

What is currently known about the uncharacterized protein AF_2239?

AF_2239 is classified as an uncharacterized protein from Archaeoglobus fulgidus, meaning its precise function remains to be determined . The protein is available as a recombinant full-length protein with a His-tag, consisting of 356 amino acids (positions 1-356) . While specific information about AF_2239's function is limited in the current literature, research on other A. fulgidus proteins suggests it may play a role in the organism's specialized metabolic or stress response pathways. The protein's uncharacterized status presents an opportunity for researchers to contribute novel findings to the field of archaeal biology. Based on the available information, AF_2239 likely represents one of many proteins in A. fulgidus whose functions remain to be elucidated through dedicated biochemical and genetic studies.

What expression systems are most effective for producing recombinant AF_2239?

E. coli expression systems have proven effective for the recombinant production of AF_2239, as evidenced by commercially available preparations of the His-tagged protein . When designing expression protocols for archaeal proteins like AF_2239, researchers should consider several methodological factors:

  • Vector selection: pET-based expression vectors containing T7 promoters often yield high expression levels for archaeal proteins in E. coli.

  • E. coli strain optimization: BL21(DE3) and its derivatives are commonly used, but Rosetta strains may be beneficial if AF_2239 contains rare codons.

  • Induction conditions: Lower temperatures (16-25°C) during induction may improve solubility despite being counterintuitive for proteins from hyperthermophiles.

  • Purification strategy: The His-tag facilitates initial purification via immobilized metal affinity chromatography (IMAC), which should be followed by size exclusion chromatography to achieve higher purity.

The choice of expression system should align with downstream applications, particularly considering that heterologous expression in E. coli might not reproduce all post-translational modifications that may occur in the native archaeal host.

How should researchers approach initial characterization of AF_2239?

Initial characterization of AF_2239 should follow a systematic, multi-faceted approach:

  • Bioinformatic analysis: Perform sequence homology searches, motif identification, and structural predictions using tools such as BLAST, PFAM, SWISS-MODEL, and AlphaFold to identify potential functional domains or structural similarities to characterized proteins.

  • Biochemical characterization: Determine basic biochemical properties including:

    • Optimal temperature and pH for stability and potential activity

    • Oligomerization state via size exclusion chromatography

    • Thermal stability using differential scanning fluorimetry

    • Substrate screening based on predicted functional domains

  • Structural studies: If higher-order information is required, employ techniques such as circular dichroism (CD) spectroscopy for secondary structure assessment, followed by more detailed techniques like X-ray crystallography or cryo-electron microscopy.

The combination of these approaches provides a comprehensive foundation for understanding AF_2239, guiding more targeted functional studies. Since A. fulgidus functions at high temperatures, all activity assays should include conditions that reflect its natural environment (83°C, anaerobic) .

What experimental designs are optimal for functional characterization of AF_2239?

Functional characterization of an uncharacterized protein like AF_2239 requires a carefully designed experimental approach that minimizes bias and maximizes information yield. Building on experimental design principles , the following methodology is recommended:

  • Randomized Block Design (RBD): This approach is particularly useful when testing AF_2239 under different conditions where environmental factors might introduce variability. Key considerations include:

    • Grouping experimental units into homogeneous blocks

    • Randomly assigning treatments within each block

    • Including appropriate controls in each block

    Example RBD setup for AF_2239 activity assays:

    Block (Temperature)Treatment 1 (Buffer A)Treatment 2 (Buffer B)Treatment 3 (Buffer C)Control
    70°CAF_2239 + SubstrateAF_2239 + SubstrateAF_2239 + SubstrateNo enzyme
    83°CAF_2239 + SubstrateAF_2239 + SubstrateAF_2239 + SubstrateNo enzyme
    95°CAF_2239 + SubstrateAF_2239 + SubstrateAF_2239 + SubstrateNo enzyme
  • Latin Square Design: When testing three factors simultaneously (e.g., temperature, pH, and substrate concentration), this design reduces the number of experimental units needed while controlling for row and column effects .

  • Fractional Factorial Design: For screening multiple potential substrates or conditions, this approach reduces experimental load while still identifying significant factors affecting AF_2239 function.

The experimental design should include replication (minimum three independent experiments) and randomization to minimize systematic errors . Statistical power analysis should be performed prior to experimentation to determine appropriate sample sizes for detecting biologically meaningful effects with confidence.

How might AF_2239 relate to DNA repair mechanisms in Archaeoglobus fulgidus?

While the specific function of AF_2239 remains uncharacterized, its potential involvement in DNA repair mechanisms warrants investigation, particularly considering A. fulgidus' sophisticated DNA repair systems that function in extreme conditions.

Research on A. fulgidus has revealed a distinct base excision repair (BER) pathway that differs from those in most eukaryotes and bacteria . This pathway employs a β-elimination mechanism rather than a hydrolytic mechanism for incision at abasic sites following uracil removal . Based on this understanding, investigating AF_2239's potential role in DNA repair could involve:

  • Co-immunoprecipitation studies: Determine if AF_2239 interacts with known DNA repair proteins in A. fulgidus, such as the family 4 uracil-DNA glycosylase (UDG).

  • DNA binding assays: Test AF_2239's ability to bind various DNA structures, including:

    • Undamaged DNA

    • DNA containing abasic sites

    • DNA with mismatches or damaged bases

  • Comparative genomics: Analyze the genomic context of AF_2239 to identify potential operonic relationships with known DNA repair genes.

  • Knockout/knockdown studies: Assess the impact of AF_2239 depletion on DNA repair efficiency, particularly under conditions causing DNA damage (e.g., high temperature, oxidative stress).

If AF_2239 is involved in DNA repair, it might represent an adaptation specific to hyperthermophilic environments where DNA damage occurs more frequently due to high temperatures .

What bioinformatic approaches can predict the function of AF_2239?

Predicting the function of an uncharacterized protein like AF_2239 requires sophisticated bioinformatic approaches that extend beyond basic sequence similarity searches:

  • Advanced homology detection:

    • Position-Specific Iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Hidden Markov Model (HMM) profiling against specialized databases

    • Structure-based alignments using predicted 3D models

  • Protein structure prediction and analysis:

    • AlphaFold2 or RoseTTAFold for high-confidence 3D structure prediction

    • Structure-based function prediction using tools like ProFunc, COACH, or COFACTOR

    • Active site prediction and comparison to known catalytic motifs

  • Genomic context analysis:

    • Examination of conserved gene neighborhoods across archaeal species

    • Identification of potential operonic relationships

    • Phylogenetic profiling to identify co-evolution patterns with functionally characterized proteins

  • Integration of multi-omics data:

    • Correlative analysis with transcriptomic data from A. fulgidus under various conditions

    • Metabolomic data integration to identify potential metabolic pathways involving AF_2239

The results from these analyses should be integrated to develop testable hypotheses about AF_2239's function, which can then be validated through targeted biochemical assays.

How can protein-protein interactions of AF_2239 be studied in the context of hyperthermophilic conditions?

Studying protein-protein interactions of AF_2239 under hyperthermophilic conditions presents unique challenges but is essential for understanding its function in the native environment of A. fulgidus. The following methodological approaches are recommended:

  • High-temperature pull-down assays:

    • Immobilize His-tagged AF_2239 on Ni-NTA resin that can withstand high temperatures

    • Incubate with A. fulgidus lysate at temperatures mimicking native conditions (80-85°C)

    • Wash and elute under high-temperature conditions

    • Identify binding partners via mass spectrometry

  • Thermostable crosslinking approaches:

    • Use thermostable crosslinkers with varying spacer arm lengths

    • Perform crosslinking at elevated temperatures in native or recombinant expression systems

    • Analyze crosslinked complexes by mass spectrometry

  • Split-protein complementation assays adapted for high temperatures:

    • Develop thermostable reporter protein systems

    • Engineer fusion constructs of AF_2239 and potential interacting partners

    • Measure reconstituted activity at elevated temperatures

  • Surface Plasmon Resonance (SPR) with thermal control:

    • Immobilize AF_2239 or potential interacting partners on a sensor chip

    • Maintain the system at elevated temperatures during interaction analysis

    • Derive kinetic and thermodynamic parameters from binding curves

Each interaction identified should be validated through multiple independent methods, and the biological significance should be assessed through functional assays that reflect the hyperthermophilic environment.

What are the potential functions of AF_2239 based on its homology to proteins in other extremophiles?

While specific information about AF_2239 homologs is limited in the provided search results, we can outline methodological approaches to identify and analyze such relationships:

  • Comparative genomic analysis across extremophiles:

    • Perform sensitive sequence searches (PSI-BLAST, HMMer) against genomes of various extremophiles

    • Identify conserved domains shared between AF_2239 and functionally characterized proteins

    • Analyze conservation patterns across phylogenetic lineages adapted to different extreme environments

  • Structural comparison with characterized extremophile proteins:

    • Generate structural models of AF_2239 using AlphaFold or similar tools

    • Compare structural features with characterized proteins from extremophiles

    • Identify potential catalytic sites or binding pockets shared with functionally known proteins

  • Experimental validation of predicted functions:

    • Design activity assays based on functions of identified homologs

    • Test recombinant AF_2239 for predicted activities under various conditions

    • Perform complementation studies in model organisms lacking homologous genes

This integrated approach combining computational predictions with experimental validation provides the most robust method for inferring AF_2239 function based on homology relationships.

What considerations are important when designing experiments to study thermal stability of AF_2239?

Studying the thermal stability of AF_2239 requires careful experimental design that accounts for the hyperthermophilic nature of A. fulgidus. The following methodological considerations are essential:

  • Differential Scanning Calorimetry (DSC) protocol:

    • Begin thermal scans at temperatures above room temperature (e.g., 40°C)

    • Extend scanning range to at least 100°C to capture the likely high melting temperature

    • Use scanning rates of 0.5-1°C/min for accurate transition temperature determination

    • Include appropriate buffer controls to account for buffer-related thermal effects

  • Circular Dichroism (CD) spectroscopy design:

    • Monitor temperature-dependent changes in secondary structure from 40-100°C

    • Use quartz cuvettes with tight-fitting stoppers to prevent evaporation

    • Collect full spectra (190-260 nm) at 5-10°C intervals for comprehensive analysis

    • Perform cooling cycles to assess reversibility of thermal denaturation

  • Experimental design considerations:

    • Use a Randomized Block Design where each "block" represents an independent protein preparation

    • Include multiple technical replicates within each biological replicate (block)

    • Randomize the order of temperature treatments to minimize systematic errors

  • Data analysis approach:

    • Fit thermal denaturation data to appropriate models (two-state or multi-state)

    • Derive thermodynamic parameters (ΔH, ΔS, ΔG) at different temperatures

    • Compare stability parameters with those of mesophilic homologs if available

This comprehensive approach provides robust characterization of AF_2239's thermal stability properties, potentially revealing adaptations that enable its function in hyperthermophilic environments.

How should researchers approach analyzing potential DNA repair activity of AF_2239?

To investigate whether AF_2239 may participate in the distinctive DNA repair pathways of A. fulgidus, a systematic experimental approach is required:

  • DNA substrate preparation:

    • Generate defined DNA substrates containing specific lesions (e.g., uracil, abasic sites)

    • Use both single-stranded and double-stranded substrates with different sequence contexts

    • Include fluorescently labeled substrates for real-time monitoring of repair activities

  • Activity assay design:

    • Compare AF_2239 activity against that of known A. fulgidus DNA repair enzymes like family 4 UDG

    • Test for glycosylase, AP lyase, or 3′-phosphodiesterase activities

    • Assess ATP/ADP-dependent stimulation of repair, which is characteristic of A. fulgidus BER

  • Experimental conditions optimization:

    • Test activity across a temperature range (60-95°C)

    • Vary pH, salt concentration, and metal ion requirements

    • Assess the impact of reducing conditions, considering A. fulgidus' anaerobic nature

  • Interaction studies with known repair factors:

    • Test for direct interactions with Afung (A. fulgidus uracil-DNA glycosylase)

    • Assess whether AF_2239 modulates the β-elimination mechanism characteristic of A. fulgidus BER

The experimental design should follow a Latin Square approach when testing multiple factors (temperature, pH, substrate type) to efficiently identify optimal conditions for activity while controlling for confounding variables .

What methodologies are recommended for studying AF_2239 under anaerobic conditions?

Studying AF_2239 under anaerobic conditions that mimic its native environment requires specialized methodologies:

  • Anaerobic chamber setup and verification:

    • Use a maintained anaerobic chamber with continuous monitoring of O₂ levels (<1 ppm)

    • Include oxygen scavengers in buffers (e.g., sodium dithionite, cysteine)

    • Verify anaerobic conditions using resazurin indicators in assay buffers

    • Pre-equilibrate all reagents and equipment in the anaerobic environment

  • Enzyme activity assay considerations:

    • Develop coupled enzyme assays compatible with anaerobic conditions

    • Use sealed cuvettes or plate readers with gas-tight seals for spectrophotometric measurements

    • Include controls to verify that anaerobiosis is maintained throughout experiments

  • Experimental design for anaerobic studies:

    • Use a Complete Randomized Design (CRD) for flexibility in anaerobic chamber experiments

    • Include aerobic controls to assess oxygen sensitivity of AF_2239

    • Test activity with varying redox potentials to identify optimal conditions

  • Handling and storage protocol:

    • Store protein samples with oxygen scavengers and under inert gas

    • Minimize freeze-thaw cycles that could introduce oxygen

    • Verify protein integrity under anaerobic conditions via activity assays before main experiments

These methodological considerations ensure that studies of AF_2239 reflect its native anaerobic environment, providing more physiologically relevant insights into its function.

What are the key unresolved questions about AF_2239 that merit further investigation?

Several critical questions about AF_2239 remain unanswered and represent valuable research opportunities:

  • Functional characterization: What is the primary biochemical function of AF_2239, and does it possess enzymatic activity?

  • Structural adaptations: How does the structure of AF_2239 contribute to its stability and function at the high temperatures characteristic of A. fulgidus?

  • Biological context: What cellular pathways involve AF_2239, and how does it contribute to A. fulgidus' survival in extreme environments?

  • Evolutionary significance: Is AF_2239 conserved across archaeal lineages, and what does this reveal about its importance?

  • Interaction network: What proteins does AF_2239 interact with, and how do these interactions change under different environmental conditions?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational biology. The answers will contribute not only to our understanding of AF_2239 specifically but also to broader knowledge about protein function and adaptation in extremophiles.

How might research on AF_2239 contribute to broader understanding of hyperthermophilic adaptations?

Research on AF_2239 has potential to advance understanding of molecular adaptations to hyperthermophilic environments in several ways:

  • Structural stability mechanisms: Detailed structural analysis of AF_2239 could reveal specific adaptations that contribute to protein stability at high temperatures, such as increased ionic interactions, disulfide bonding, or hydrophobic core packing.

  • Novel functional mechanisms: If enzymatic activity is identified, AF_2239 might employ unique catalytic mechanisms adapted to function optimally at high temperatures, potentially revealing new principles of enzyme catalysis.

  • Extremophile systems biology: Placing AF_2239 within its biological context through interaction studies and functional characterization would contribute to a systems-level understanding of how hyperthermophilic archaea coordinate cellular processes.

  • Evolutionary insights: Comparative analysis of AF_2239 with homologs from organisms adapted to different extreme environments could illuminate the evolutionary trajectories of protein adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.