Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2393 (AF_2393)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Archaeoglobus fulgidus Uncharacterized Protein AF_2393 (AF_2393)

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2393 (AF_2393) is a recombinant protein derived from the hyperthermophilic archaeon Archaeoglobus fulgidus. This organism is known for its ability to thrive in extremely high temperatures, typically between 60°C and 95°C, and is involved in sulfur metabolism . The protein AF_2393 is produced using an in vitro Escherichia coli expression system, which allows for high purity and controlled production conditions .

Background on Archaeoglobus fulgidus

Archaeoglobus fulgidus is a microorganism that belongs to the domain Archaea. It is notable for its thermophilic nature and its role in sulfur reduction processes. The organism's genome contains a variety of genes encoding proteins with diverse functions, many of which remain uncharacterized . The study of these proteins can provide insights into the unique physiological adaptations of A. fulgidus and its ability to survive in extreme environments.

Characteristics of Recombinant AF_2393

  • Production Method: Recombinant AF_2393 is produced in an E. coli expression system, which is a common method for producing recombinant proteins due to its efficiency and cost-effectiveness .

  • Purity: The protein is available in high purity, which is crucial for research applications where precise biochemical properties are required.

  • Function: Currently, the specific biological function of AF_2393 is not well understood. It is classified as an uncharacterized protein, indicating that further research is needed to determine its role in A. fulgidus.

Data Table: Comparison of Recombinant Proteins from Archaeoglobus fulgidus

Protein IDDescriptionProduction MethodKnown Function
AF_2393Uncharacterized proteinE. coli expression systemUnknown
AF_2331Orphan protein with α + β foldNot specifiedHypothetical complex formation
AF_2241Hypothetical protein with cyclophilin-like foldNot specifiedDistinct biological function proposed
AF_1298DNA binding protein involved in heat shock responseE. coli expression systemGene regulation

Future Directions

Further research on AF_2393 and other uncharacterized proteins from A. fulgidus could reveal novel biological functions and structural insights. This could involve structural studies using techniques like X-ray crystallography or NMR spectroscopy, as well as functional assays to determine the protein's role in the organism.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if you have a specific requirement. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
AF_2393; Uncharacterized protein AF_2393
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2393
Target Protein Sequence
MGCICGHLQLLGCLRHCLNRNGGGTLVVAFAFTAFFSLLTILEVLSALNIFGGEGTLMNA FVLGTITATFAKGVVVRRDSYLFVASLLAAAFSVLMILVYMASGSFSYGIFGLVTVPYLV KKARK
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2393

STRING: 224325.AF2393

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.