Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2423 (AF_2423)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
AF_2423; Uncharacterized protein AF_2423
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_2423
Target Protein Sequence
MITLLNLLLAEIAGFITYQHFTASPLRYFIPYPAELLLFAIPLVGLAVRRPFSFYYYSVL IFFNISPILARSETFEGIIDTLNAIDALYNTGTSAIAESLKVAFIGHSTSVDGLLAVTWL YILAEVFQGNWESIKGAKTGGVEIERAYLVYLPAFFFALLVYFLYPFLMSEIDFGLERIV AAVLGIAAFFAGVYLLSRGVEEEDINSGG
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_2423

STRING: 224325.AF2423

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the biochemical properties of Archaeoglobus fulgidus protein AF_2423?

AF_2423 is an uncharacterized protein from the extremophile Archaeoglobus fulgidus, a sulfate-reducing archaeon capable of growth under extreme conditions including high temperatures (optimal growth at 83°C) and high hydrostatic pressures (up to 60 MPa for heterotrophic metabolism) . Current biochemical characterization is limited, but based on genomic analysis, this protein is likely adapted to function under extreme conditions similar to other proteins from this organism. Preliminary analysis suggests potential roles in stress response or metabolic pathways related to A. fulgidus' ability to perform both heterotrophic metabolism (lactate oxidation coupled to sulfate reduction) and autotrophic CO₂ fixation (coupled to thiosulfate reduction) .

How should I design expression systems for recombinant production of A. fulgidus AF_2423?

When designing expression systems for AF_2423, consider the following methodological approach:

  • Host selection: E. coli BL21(DE3) or Rosetta strains are commonly used for archaeal proteins, but consider thermophilic expression hosts for proteins that may require high-temperature folding.

  • Vector design: Include a heat-stable selection marker and appropriate tags (His6, GST, or MBP) that can be cleaved post-purification.

  • Codon optimization: Optimize codons for the expression host while maintaining critical structural elements.

  • Culture conditions: Use rich media (such as TB or 2xYT) supplemented with appropriate antibiotics.

  • Induction parameters: For E. coli systems, optimize IPTG concentration (typically 0.1-1.0 mM) and induction temperature (16-25°C may improve solubility despite being derived from a hyperthermophile).

Expression should be validated through SDS-PAGE and Western blotting before proceeding to purification steps.

What approaches should be used for initial functional characterization of AF_2423?

Initial functional characterization should follow a systematic approach:

  • Sequence analysis: Perform comprehensive bioinformatic analysis including homology modeling, domain prediction, and phylogenetic analysis to identify potential functions.

  • Localization studies: Determine cellular localization using fluorescent protein fusions or immunolocalization techniques.

  • Interaction partners: Perform pull-down assays, yeast two-hybrid screening, or co-immunoprecipitation to identify protein interaction partners.

  • Biochemical assays: Based on bioinformatic predictions, design assays to test enzymatic activities under various conditions, particularly testing function at high temperatures (80-85°C) and pressures (0.1-60 MPa) to mimic A. fulgidus' natural environment .

  • Structural studies: Obtain preliminary structural information using circular dichroism spectroscopy to assess secondary structure elements and thermal stability.

Record all negative results as they are equally valuable in narrowing down potential functions.

How does high hydrostatic pressure affect the structure and function of AF_2423?

This requires a sophisticated experimental approach to mimic the natural high-pressure environment of A. fulgidus:

  • High-pressure biophysical studies: Utilize high-pressure spectroscopic techniques (HP-CD, HP-FTIR) to monitor structural changes under increasing pressure up to 60 MPa .

  • Functional assays under pressure: Design specialized high-pressure vessels similar to those used for A. fulgidus cultivation to test enzymatic activity under various pressures (see Figure 1 below for reference experimental setup).

  • Comparative analysis: Compare activity and stability profiles across a pressure range (0.1-60 MPa) and temperature range (70-90°C) to identify optimal conditions and pressure adaptation mechanisms.

  • Molecular dynamics simulations: Perform in silico analysis of protein structural dynamics under varying pressure conditions to identify key pressure-responsive elements.

Table 1: Suggested experimental conditions for AF_2423 functional characterization

Metabolism TypePressure Range (MPa)Temperature (°C)Carbon SourceElectron AcceptorExpected Growth Rate
Heterotrophic0.1-20 (optimal)83LactateSulfateHigh
Heterotrophic20-6083LactateSulfateModerate
Heterotrophic60-7083LactateSulfateLow/None
Autotrophic0.1-4083CO₂ThiosulfateConstant
Autotrophic>4083CO₂ThiosulfateDecreasing

How can structural biology approaches be optimized for determining the three-dimensional structure of AF_2423?

For structural determination of extremophile proteins like AF_2423:

  • Crystallization optimization:

    • Screen conditions at both ambient and elevated temperatures

    • Include additives that mimic the native environment (high salt concentrations)

    • Utilize specialized crystallization techniques for challenging proteins (lipidic cubic phase, microseeding)

  • Cryo-EM considerations:

    • Optimize buffer conditions to prevent aggregation

    • Implement vitrification protocols optimized for thermostable proteins

    • Consider using specialized grids with thin carbon films for improved particle distribution

  • NMR approaches:

    • Produce isotopically labeled protein (¹³C, ¹⁵N)

    • Optimize sample stability at high temperatures during data collection

    • Consider high-pressure NMR for native-like conditions

  • Thermal stability assessment:

    • Compare stability at different temperatures (20-100°C) and pressures (0.1-60 MPa)

    • Use differential scanning calorimetry (DSC) and thermal shift assays to identify stabilizing conditions

  • Computational approaches:

    • Implement homology modeling incorporating extremophile-specific parameters

    • Validate structural predictions with limited experimental data (CD spectroscopy, SAXS)

What purification protocols are most effective for recombinant AF_2423?

For optimal purification of recombinant AF_2423:

  • Cell lysis optimization:

    • Test mechanical (sonication, high-pressure homogenization) and chemical (detergents, lysozyme) methods

    • Include protease inhibitors optimized for thermostable proteins

    • Consider heat treatment (60-70°C for 20 minutes) to precipitate host proteins while retaining AF_2423

  • Chromatography sequence:

    • Primary capture: Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Intermediate purification: Ion exchange chromatography based on predicted pI

    • Polishing: Size exclusion chromatography in buffers mimicking native conditions

  • Buffer optimization:

    • Test stability in buffers containing various salt concentrations (0.1-0.5M NaCl)

    • Evaluate pH range stability (pH 6.0-8.0)

    • Include stabilizing additives (glycerol 5-10%, reducing agents)

  • Quality control:

    • Assess purity by SDS-PAGE (>95%)

    • Verify identity by mass spectrometry

    • Confirm proper folding using circular dichroism

Table 2: Recommended purification protocol for recombinant AF_2423

Purification StepMethodBuffer CompositionParameter Optimization
Cell lysisSonication with heat treatment50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTTHeat at 65°C for 20 min
IMACNi-NTA50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole gradientFlow rate: 1 ml/min
Tag cleavageTEV protease50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM DTTIncubate 1:50 ratio at 25°C for 16h
Ion exchangeQ-Sepharose20 mM Tris-HCl pH 8.0, 50-500 mM NaCl gradientFlow rate: 2 ml/min
Size exclusionSuperdex 75/20020 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTTFlow rate: 0.5 ml/min

How should stability assays be designed to evaluate AF_2423 under extreme conditions?

Design stability assays that account for the extremophilic origin of AF_2423:

  • Thermal stability assessment:

    • Differential scanning fluorimetry (DSF) with temperature ranges from 25-110°C

    • Circular dichroism (CD) spectroscopy with temperature ramping (25-95°C)

    • Activity retention assays after thermal challenges at various time points

  • Pressure stability protocols:

    • Design assays in pressure vessels similar to those used for A. fulgidus cultivation (0.1-60 MPa)

    • Monitor structural integrity after pressure treatment using spectroscopic methods

    • Assess activity recovery following pressure exposure

  • Chemical denaturation:

    • Titrate with denaturants (urea, guanidinium-HCl) at concentrations up to 8M

    • Monitor unfolding using intrinsic tryptophan fluorescence or CD spectroscopy

    • Calculate free energy of unfolding (ΔG) at different temperatures

  • Long-term storage optimization:

    • Test various buffer compositions, pH ranges, and additives

    • Monitor activity retention over time at different storage temperatures

    • Evaluate freeze-thaw stability over multiple cycles

  • Oxidative stability:

    • Challenge with oxidizing agents (H₂O₂, metal ions)

    • Monitor structural changes and activity loss

    • Identify protective conditions or additives

What bioinformatic approaches should be used to predict potential functions of AF_2423?

Implement a comprehensive bioinformatic workflow:

  • Sequence analysis:

    • Perform BLASTp against non-redundant, UniProt, and specialized archaeal databases

    • Identify conserved domains using InterPro, PFAM, and CDD

    • Search for sequence motifs using PROSITE and MOTIF

  • Structural prediction:

    • Generate 3D models using AlphaFold2 or RoseTTAFold

    • Validate models using PROCHECK, VERIFY3D, and MolProbity

    • Perform structural alignment with known proteins using DALI and TM-align

  • Functional inference:

    • Identify potential binding sites using CASTp and SiteMap

    • Predict catalytic residues using CSA and POOL servers

    • Perform ligand docking if binding pockets are identified

  • Phylogenetic analysis:

    • Construct multiple sequence alignments of homologs

    • Build phylogenetic trees to identify functional clustering

    • Analyze conservation patterns across archaeal and bacterial domains

  • Network-based prediction:

    • Identify potential interaction partners using STRING database

    • Predict functional associations based on genomic context

    • Analyze gene neighborhood and co-occurrence patterns

Table 3: Key bioinformatic tools for AF_2423 functional prediction

Analysis TypeRecommended ToolsExpected OutputsInterpretation Guidelines
Sequence homologyBLASTp, HHpred, HMMERAlignment scores, E-valuesE-value < 1e-5 suggests homology
Domain predictionInterPro, PFAM, CDDDomain architectureFocus on domains found in extremophiles
Structure predictionAlphaFold2, I-TASSER3D models, confidence scorespLDDT > 70 indicates reliable regions
Binding site detectionCASTp, SiteMap, FTMapPotential binding pocketsVolume > 100 ų suggests functional sites
Evolutionary analysisMEGA, IQ-TREEPhylogenetic treesCluster analysis with other characterized proteins

How should contradictory experimental results on AF_2423 function be reconciled?

When faced with conflicting data regarding AF_2423 function:

  • Systematic validation:

    • Independently repeat key experiments using different methods

    • Verify protein quality and activity before each experiment

    • Test for assay interference factors

  • Condition-dependent function analysis:

    • Explore whether AF_2423 exhibits different functions under varying conditions

    • Test activity across a matrix of temperatures (60-95°C) and pressures (0.1-60 MPa)

    • Consider pH, salt concentration, and redox conditions as variables

  • Multifunctional protein assessment:

    • Investigate whether AF_2423 exhibits moonlighting functions

    • Design assays to test multiple predicted activities simultaneously

    • Compare kinetic parameters across different substrates

  • Structural dynamics investigation:

    • Determine if conformational changes might explain functional variability

    • Use hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Consider allosteric regulation mechanisms

  • Collaborative verification:

    • Engage with other labs to independently validate critical findings

    • Standardize protocols across research groups

    • Pool data for meta-analysis

What considerations are important when interpreting AF_2423 data from in vitro versus in vivo studies?

When reconciling in vitro and in vivo findings:

  • Environmental differences:

    • Account for the extreme conditions of A. fulgidus' natural habitat

    • Design in vitro experiments that mimic in vivo conditions (83°C, high pressure)

    • Consider the effects of cellular crowding on protein function

  • Interaction networks:

    • In vitro studies may miss critical interaction partners

    • Complement biochemical assays with in vivo localization studies

    • Consider reconstitution experiments with potential partners

  • Post-translational modifications:

    • Identify potential PTMs in native AF_2423

    • Assess whether recombinant systems reproduce these modifications

    • Test the functional impact of identified modifications

  • Metabolic context:

    • Consider the metabolic state of A. fulgidus under experimental conditions

    • Design experiments that account for both heterotrophic and autotrophic metabolisms

    • Measure activity in the presence of relevant metabolites

  • Temporal considerations:

    • Account for growth phase-dependent expression patterns

    • Design time-course experiments to capture dynamic processes

    • Consider protein turnover rates when interpreting results

How can CRISPR-Cas9 genome editing be adapted for studying AF_2423 function in A. fulgidus?

Implementing CRISPR-Cas9 in extremophiles requires specialized approaches:

  • Thermostable CRISPR systems:

    • Identify and optimize Cas9 variants from thermophilic organisms

    • Engineer enhanced thermostability into existing Cas9 proteins

    • Test activity at high temperatures (80-85°C)

  • Delivery optimization:

    • Develop transformation protocols optimized for A. fulgidus

    • Consider protoplast fusion or electroporation methods

    • Design selectable markers functional at high temperatures

  • Guide RNA design:

    • Optimize RNA stability for high-temperature environments

    • Design guides with high specificity for AF_2423

    • Validate guide efficiency in vitro before in vivo implementation

  • Editing strategy:

    • Design homology-directed repair templates with extended homology arms

    • Create both knockout and knock-in strategies (His-tag, fluorescent reporters)

    • Implement inducible systems to study essential genes

  • Phenotypic analysis:

    • Compare growth rates of mutants across pressure ranges (0.1-60 MPa)

    • Assess metabolic capabilities in both heterotrophic and autotrophic conditions

    • Conduct global transcriptomic and proteomic analyses of mutants

What mass spectrometry approaches are most suitable for characterizing post-translational modifications of AF_2423?

For comprehensive PTM characterization:

  • Sample preparation optimization:

    • Develop extraction protocols that preserve labile modifications

    • Test multiple proteases for optimal sequence coverage (trypsin, chymotrypsin, GluC)

    • Include modification-specific enrichment strategies

  • MS instrumentation selection:

    • High-resolution MS (Orbitrap, Q-TOF) for accurate mass determination

    • ETD/ECD fragmentation for intact modification mapping

    • Ion mobility MS for separation of isomeric modifications

  • Data acquisition strategies:

    • Implement data-dependent acquisition for discovery

    • Targeted approaches (PRM, MRM) for validation of identified PTMs

    • Data-independent acquisition for comprehensive site localization

  • Bioinformatic analysis:

    • Use specialized search engines (MSFragger, MetaMorpheus) with open modification searches

    • Implement site localization algorithms (PTM-score, Ascore)

    • Develop custom databases incorporating archaeal-specific modifications

  • Functional validation:

    • Compare modification patterns under different growth conditions

    • Generate site-directed mutants of modified residues

    • Correlate modification status with protein activity and stability

Table 4: Common PTMs to investigate in archaeal proteins

Modification TypeMass Shift (Da)Enrichment StrategyFragmentation MethodBiological Significance
Phosphorylation+79.97TiO₂, IMACHCD, ETDSignaling, regulation
Methylation+14.02Antibody-basedHCDProtein stability
Acetylation+42.01Antibody-basedHCDRegulation, stability
ADP-ribosylation+541.06Binding proteinsETDStress response
GlycosylationVariableLectin affinityHCD-ETDStability, recognition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.