Recombinant Archaeoglobus fulgidus UPF0118 membrane protein AF_1800 (AF_1800)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The protein is expressed in E. coli systems, followed by affinity chromatography using the His tag . Key protocols include:

  • Expression vector: Customized for high-yield production in E. coli .

  • Reconstitution: Requires addition of 5–50% glycerol for stability .

  • Buffer: Tris/PBS-based with 6% trehalose (pH 8.0) .

Stability Considerations:

  • Avoid repeated freeze-thaw cycles .

  • Working aliquots stable at 4°C for ≤1 week .

Functional Insights

UPF0118 family proteins exhibit pH-dependent Na+(Li+)/H+ antiport activity, critical for ion homeostasis in extremophiles . Key findings:

Functional AssayResults
Na+/H+ antiport activityObserved at pH 8.5–9.0; minimal at pH 7.0 .
Phylogenetic analysisClusters distinctly from known antiporters (bootstrap value: 92%) .
Structural rolePredicted 6–8 transmembrane helices .

This protein’s ion transport mechanism is being studied for applications in bioenergetics and synthetic biology .

Research Applications

  • Structural studies: Used in crystallography and cryo-EM due to thermostability .

  • Ion transport mechanisms: Serves as a model for pH-dependent antiporters .

  • Biotechnology: Explored for enzyme stabilization in industrial processes .

Limitations and Future Directions

  • Functional ambiguity: DUF20’s exact role remains uncharacterized .

  • Research gaps: In vivo studies in A. fulgidus are needed to confirm in vitro observations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your needs when placing the order. We will prepare the product according to your requirements.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize the development of your desired tag.
Synonyms
AF_1800; Putative transport protein AF_1800
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_1800
Target Protein Sequence
MNKYWTLVLLLSILVVLALTFYFFTPLLDGIVMGVVFAYVAKPVKRKIEHVGRIKASVIA TAIVILPISVLMFYGLIQGLNQAIYLITHYKVIESGILNILSKMGIEEGEEYVKWITSNV FSILQSSIQPSAVEITKKATLLILNFFISIVVCFYALADMENFVRRTTSVVPEDRRDEFR RFVEEIDVTFESLWFGNFVVAILIGLVSLPFFLYFNVPFAPLLSGLMFLAALIPIFAEWM IILPVSLYLLLVDVGRGLSFLLIGVVFLYVLPELILRPYFVGYTSKIHPLVLMLAFIGGG LVGGISGFFIAPMIVGLATAIYNYYTKEELATENHDPESV
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_1800

STRING: 224325.AF1800

Protein Families
Autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus UPF0118 membrane protein AF_1800?

Archaeoglobus fulgidus UPF0118 membrane protein AF_1800 is a 340-amino acid transmembrane protein belonging to the UPF0118 protein family. This protein originates from the hyperthermophilic archaeon Archaeoglobus fulgidus, an organism known for its ability to thrive in extreme environments. The protein contains the domain of unknown function (DUF20), which is characteristic of the UPF0118 family. While the specific function of AF_1800 remains to be fully elucidated, related proteins in this family have recently been identified to possess ion antiporter activity, suggesting AF_1800 may play a role in ion homeostasis in A. fulgidus .

How is AF_1800 classified within protein databases?

AF_1800 is classified as a member of the UPF0118 protein family (UPF standing for "Uncharacterized Protein Family"). This classification places it among proteins with conserved sequences but initially unknown functions. The protein contains the conserved domain DUF20 (Domain of Unknown Function 20), which is characteristic of this family. Recent research on homologous proteins suggests that members of this family may function as ion antiporters, specifically Na+(Li+)/H+ antiporters, though this has not been conclusively demonstrated for AF_1800 specifically. Within the context of Archaeoglobus fulgidus proteome, AF_1800 is categorized as a membrane protein, reflecting its predicted transmembrane topology .

What is currently known about the evolutionary conservation of AF_1800?

While specific evolutionary analysis of AF_1800 is limited in the available literature, insights can be drawn from studies of the UPF0118 family. UPF0118 family proteins have been identified across various bacterial and archaeal species, suggesting ancient evolutionary origins. Phylogenetic analysis of a related UPF0118 protein demonstrated clustering of homologs with identity ranges of 22-82%, indicating significant conservation despite considerable sequence divergence. This conservation pattern suggests functional importance across diverse prokaryotic lineages. The retention of this protein family across evolutionary distance, particularly in extremophiles like Archaeoglobus fulgidus and Halobacillus species, indicates potential roles in basic cellular processes such as ion homeostasis that are fundamental to survival in challenging environments .

What expression systems are most effective for producing recombinant AF_1800?

For recombinant expression of AF_1800, Escherichia coli has been demonstrated as an effective heterologous host system. The protein is available as a His-tagged recombinant form expressed in E. coli, suggesting successful heterologous expression. When working with archaeal membrane proteins like AF_1800, several E. coli strains may be considered, including BL21(DE3), C41(DE3), or C43(DE3), with the latter two being particularly suitable for membrane proteins that might be toxic to the host. Expression vectors featuring T7 promoters with controllable induction (such as pET series vectors) are typically employed. For optimal expression of this thermophilic protein, lower induction temperatures (16-25°C) and extended induction times may help proper folding despite the temperature difference between the mesophilic host and thermophilic native environment .

What purification challenges are specific to AF_1800, and how can they be addressed?

Purification of AF_1800, like many membrane proteins, presents several specific challenges that require methodological consideration. The hydrophobic nature of membrane proteins like AF_1800 necessitates careful detergent selection for solubilization and purification. Common detergents for archaeal membrane proteins include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or lauryl maltose neopentyl glycol (LMNG). The His-tagged version of AF_1800 enables purification via immobilized metal affinity chromatography (IMAC), typically using Ni-NTA resin. Temperature stability should be considered during purification, as proteins from hyperthermophiles like A. fulgidus often exhibit enhanced stability at elevated temperatures. Size exclusion chromatography (SEC) as a final purification step helps ensure homogeneity and removal of aggregates. When preparing samples for structural studies, detergent screening or replacement with amphipols or nanodiscs may be necessary to maintain native-like environments .

How can researchers verify the correct folding and stability of purified AF_1800?

Verifying correct folding and stability of purified AF_1800 requires multiple complementary approaches. Circular dichroism (CD) spectroscopy can assess secondary structure composition, with expected alpha-helical signatures for transmembrane proteins. Thermal shift assays can determine thermal stability, which is particularly relevant for proteins from hyperthermophiles like A. fulgidus, where higher melting temperatures would be expected. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can confirm monodispersity and oligomeric state. For membrane proteins like AF_1800, fluorescence-based approaches including intrinsic tryptophan fluorescence or extrinsic dyes like SYPRO Orange can monitor thermal unfolding transitions. Additionally, limited proteolysis can identify flexible or misfolded regions, while negative stain electron microscopy can provide visual confirmation of particle homogeneity. Functional assays, such as liposome-based ion transport measurements (if the protein functions as an antiporter like other UPF0118 family members), ultimately provide the strongest evidence for proper folding .

What computational methods can predict the structure of AF_1800?

Several computational methods can effectively predict the structure of AF_1800. Contemporary protein structure prediction tools like AlphaFold or RoseTTAFold would be particularly valuable for generating high-confidence models of AF_1800. These methods leverage deep learning approaches trained on protein structure databases and have demonstrated remarkable accuracy for membrane proteins. For transmembrane topology prediction specifically, specialized tools like TMHMM, DeepTMHMM, or TOPCONS can identify transmembrane helices and their orientation. Homology modeling using related UPF0118 family members with solved structures as templates represents another approach, though the availability of such templates may be limited. Molecular dynamics simulations can further refine predicted structures, particularly to assess stability within a lipid bilayer environment. Coevolutionary analysis methods (such as EVfold or RaptorX) can provide contact predictions that inform structural modeling. These computational predictions should be validated experimentally whenever possible .

What experimental techniques are most promising for solving the structure of AF_1800?

Given AF_1800's nature as a membrane protein, several complementary experimental techniques hold promise for structural determination. X-ray crystallography remains a powerful approach, though it requires forming well-diffracting crystals, which can be challenging for membrane proteins. Techniques like lipidic cubic phase (LCP) crystallization may increase success probability. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and could be effective for AF_1800, particularly if it forms oligomers or complexes. Small-angle X-ray scattering (SAXS) can provide low-resolution structural information in solution. Nuclear magnetic resonance (NMR) spectroscopy, particularly solid-state NMR, can reveal structural details and dynamics of membrane proteins. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map solvent-accessible regions and conformational dynamics. Cross-linking mass spectrometry (XL-MS) can identify spatial proximities between protein regions. For transmembrane topology validation, cysteine accessibility methods or electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling can provide experimental constraints .

How might the structure of AF_1800 relate to its potential function?

The structure of AF_1800 likely holds key insights into its functional mechanisms, particularly if it operates as an ion antiporter like other UPF0118 family members. Transmembrane helices would create a pathway for ion translocation across the membrane, with specific residues forming the ion-binding sites and selectivity filters. The DUF20 domain's structural features may reveal conserved motifs involved in ion recognition and transport. Comparison with structures of characterized ion antiporters could identify similar structural elements despite low sequence identity. The protein might demonstrate conformational changes associated with the alternating access mechanism typical of transporters, where the substrate-binding site alternately faces opposite sides of the membrane. Structural analysis could also reveal oligomerization interfaces if functional units require multiple subunits. Additionally, the thermostability of proteins from hyperthermophiles like A. fulgidus is often reflected in structural features such as increased hydrophobic interactions, additional salt bridges, and more compact packing of secondary structure elements .

How can researchers investigate the potential ion transport activity of AF_1800?

To investigate potential ion transport activity of AF_1800, researchers should consider multiple complementary approaches. Liposome-based assays represent a gold standard, where purified AF_1800 is reconstituted into liposomes loaded with pH-sensitive or ion-sensitive fluorescent dyes (like BCECF for pH or SBFI for Na+). Transport is then monitored in response to ion gradients. Alternatively, solid-supported membrane (SSM)-based electrophysiology can detect charge movements associated with electrogenic transport. Cell-based complementation assays using E. coli strains deficient in specific ion transporters (such as the Na+/H+ antiporter-deficient strain KNabc) can assess whether AF_1800 expression rescues growth phenotypes under ion stress conditions. Isothermal titration calorimetry (ITC) can determine ion binding affinities and thermodynamics. Fluorescence-based ion binding assays using intrinsic tryptophan fluorescence may detect conformational changes upon ion binding. pH-dependent activity profiles should be established, as the related UPF0118 protein showed pH-dependent Na+(Li+)/H+ antiport activity. Ion selectivity could be assessed by competition experiments with various cations .

What approaches can determine AF_1800's substrate specificity and kinetic parameters?

Determining AF_1800's substrate specificity and kinetic parameters requires systematic investigation using transport assays with varying substrate concentrations. Radioactive tracer-based uptake or efflux assays using isotopes like 22Na+, 36Cl-, or other relevant ions can directly quantify transport rates under different conditions. Liposome-based fluorescence assays with ion-specific fluorescent indicators allow real-time monitoring of transport activities. For kinetic parameter determination, initial rate measurements at varying substrate concentrations would generate data for Michaelis-Menten analysis, yielding KM (substrate affinity) and Vmax (maximum transport rate) values. Inhibitor studies using known transport inhibitors (e.g., amiloride for Na+/H+ exchangers) can provide mechanistic insights. Substrate competition assays assess relative affinities for different ions by measuring how one ion affects transport of another. Electrophysiological techniques like patch-clamping of proteoliposomes or oocyte expression systems can measure current-voltage relationships and determine electrogenicity of transport. pH dependence profiles should be established, as related UPF0118 proteins show pH-dependent activity .

How can researchers identify potential interaction partners of AF_1800?

Identification of potential interaction partners of AF_1800 requires both unbiased screening approaches and targeted validation methods. Pull-down assays using His-tagged AF_1800 as bait can capture interacting proteins from A. fulgidus lysates, followed by mass spectrometry identification. Co-immunoprecipitation with AF_1800-specific antibodies represents another approach for capturing protein complexes. Proximity-based labeling methods like BioID or APEX2, where AF_1800 is fused to a biotin ligase or peroxidase, can identify proteins in close proximity in vivo. Bacterial or yeast two-hybrid screening can systematically test binary interactions. Cross-linking mass spectrometry (XL-MS) can capture transient interactions. For membrane protein interactions specifically, membrane yeast two-hybrid or split-ubiquitin systems may be more appropriate than conventional two-hybrid approaches. Functional validation of identified interactions can be performed through co-purification, fluorescence resonance energy transfer (FRET), or bioluminescence resonance energy transfer (BRET). Genetic approaches like synthetic lethality or suppressor screens in model organisms expressing AF_1800 can reveal functional relationships .

What insights from other UPF0118 proteins can guide AF_1800 research?

Insights from characterized UPF0118 family proteins provide valuable direction for AF_1800 research. The demonstration that a UPF0118 protein from H. andaensis functions as a Na+(Li+)/H+ antiporter strongly suggests investigating similar activity in AF_1800. The pH-dependent nature of this antiport activity indicates that pH sensitivity assays should be a priority when characterizing AF_1800. Methodologically, the successful approach used with the H. andaensis protein—functional complementation in E. coli strains lacking endogenous Na+/H+ antiporters followed by biochemical characterization—provides a proven framework for AF_1800 study. The distinction between UPF0118 proteins and other characterized antiporters in phylogenetic analysis suggests that AF_1800 may employ novel structural mechanisms for ion transport. The finding that UPF0118 represents a previously unrecognized class of Na+(Li+)/H+ antiporters validates the importance of studying apparently "uncharacterized" protein families and indicates that AF_1800 research could significantly expand our understanding of ion transport mechanisms. Additionally, the extremophilic nature of A. fulgidus suggests investigating how AF_1800 might be adapted for function under high temperature and potentially anaerobic conditions .

What evolutionary relationships exist between AF_1800 and UPF0118 proteins from other extremophiles?

The evolutionary relationships between AF_1800 and UPF0118 proteins from other extremophiles reflect adaptation to diverse extreme environments while maintaining core functional properties. UPF0118 family proteins are found across various extremophiles, including both thermophilic archaea like Archaeoglobus fulgidus and halophilic bacteria like Halobacillus species. Phylogenetic analysis of UPF0118 family members has shown clustering with bootstrap values of 92%, indicating strong evolutionary relationships despite sequence divergence. This conservation across phylogenetically distant extremophiles suggests fundamental roles in cellular homeostasis under extreme conditions. The presence of UPF0118 proteins in organisms adapted to different extreme environments (high temperature, high salinity, etc.) indicates evolutionary divergence to optimize function under specific stress conditions. While maintaining core functional domains (DUF20), specific residues likely evolved to accommodate the particular ionic environments and membrane compositions of different extremophiles. Archaeoglobus fulgidus, as a hyperthermophilic sulfate-reducing archaeon, would require adaptations for function at high temperatures (80-95°C), potentially reflected in specific thermostabilizing features in AF_1800 compared to mesophilic homologs .

How might AF_1800 contribute to our understanding of archaeal membrane biology?

AF_1800 offers unique insights into archaeal membrane biology due to several distinctive characteristics. As a membrane protein from a hyperthermophilic archaeon, AF_1800 must function within the unusual archaeal membrane architecture, which features ether-linked isoprenoid lipids rather than the ester-linked fatty acids found in bacteria and eukaryotes. Studying how AF_1800 integrates into and functions within this distinct membrane environment could reveal adaptation mechanisms for protein-lipid interactions under extreme conditions. If confirmed as an ion antiporter like other UPF0118 members, AF_1800 would contribute to understanding how Archaeoglobus fulgidus maintains ion homeostasis at high temperatures (optimal growth at 83°C). The apparent evolutionary divergence of UPF0118 proteins from other characterized ion transporters suggests that archaea may employ novel molecular mechanisms for fundamental cellular processes. Additionally, as A. fulgidus represents an evolutionary lineage that diverged early in cellular evolution, characterizing AF_1800 contributes to understanding the diversity and evolution of membrane transport systems. The protein may also reveal insights into adaptations for life in hydrothermal environments, where ion gradients can fluctuate rapidly .

What potential biotechnological applications might derive from AF_1800 research?

Research on AF_1800 could lead to several valuable biotechnological applications, particularly leveraging its archaeal origin and potential ion transport capabilities. If confirmed as a thermostable ion antiporter, AF_1800 could serve as a robust component in bioremediation technologies targeting metal-contaminated environments at elevated temperatures. The protein's structure could inform the design of synthetic transporters with enhanced stability for industrial applications requiring function under harsh conditions. As a protein from a hyperthermophile, AF_1800 might exhibit exceptional stability that could be transferred to other proteins through domain fusion or structure-guided protein engineering. If AF_1800 demonstrates specific ion selectivity, it could be developed into biosensors for environmental monitoring or industrial process control. Understanding the structure-function relationships in AF_1800 could guide the development of novel antimicrobials targeting related transport proteins in pathogenic prokaryotes. Additionally, thermostable membrane proteins like AF_1800 represent valuable model systems for structural biology method development, potentially improving techniques for studying more medically relevant but less stable membrane proteins .

How can systems biology approaches enhance our understanding of AF_1800's role in Archaeoglobus fulgidus?

Systems biology approaches can provide comprehensive contextual understanding of AF_1800's role within the broader cellular network of Archaeoglobus fulgidus. Transcriptomic analysis under various growth conditions (different temperatures, pH levels, salt concentrations, etc.) can reveal co-expression patterns between AF_1800 and other genes, suggesting functional relationships. Proteomics approaches, particularly quantitative membrane proteomics, can determine how AF_1800 abundance changes in response to environmental challenges. Metabolomics can identify metabolic shifts associated with AF_1800 expression levels, potentially revealing downstream effects of its transport activity. Integration of these multi-omics data through computational modeling can generate testable hypotheses about AF_1800's role in cellular networks. Comparative genomics across Archaeoglobus species and other related archaea can provide evolutionary context for AF_1800 function. Analysis of genomic context—examining genes adjacent to AF_1800—may reveal functional associations, as genes involved in related processes are often clustered in prokaryotic genomes. Gene knockout or knockdown studies, if technically feasible in A. fulgidus, would provide direct evidence of AF_1800's physiological importance. Additionally, adaptive laboratory evolution experiments under selective pressures relevant to ion transport could reveal compensatory mechanisms when AF_1800 function is compromised .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.