Recombinant Archaeoglobus fulgidus UPF0132 membrane protein AF_0105 (AF_0105)

Shipped with Ice Packs
In Stock

Description

Product Overview

AF_0105 is a recombinant UPF0132 family membrane protein fused with an N-terminal His tag for efficient purification. Its full-length sequence (1–103 aa) includes the complete transmembrane domain critical for studying membrane-protein interactions and stability . The protein is lyophilized or provided in a Tris-based buffer with trehalose or glycerol for optimal stability .

Key Attributes

ParameterValue/Description
Source OrganismArchaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304)
Host SystemE. coli
TagN-terminal His tag
Protein LengthFull-length (1–103 aa)
UniProt IDO30131
Gene NameAF_0105

Amino Acid Sequence

The primary sequence of AF_0105 is:
MKENVAGALSYLLGPITGILFLLMEKESQFVKFHAMQSTITFAGFWVLDIALSFIPYIGVLLIPIVGLVAFITWLVCIYKAYSNEWFKLPVVGDIAEQQIGGV .

Purity and Quality Control

SourcePurity MethodPurity Level
Creative BioMart SDS-PAGE>90%
Cusabio SDS-PAGE>85%

Research Applications

While specific functional studies are not detailed in available sources, AF_0105 is utilized in:

  • Structural Biology: Studying archaeal membrane protein folding and stability .

  • ELISA Kits: As an antigen in immunoassays (e.g., Anagnostics’ ELISA kit for detection) .

  • Pathway Analysis: Investigating UPF0132 family protein roles in membrane-associated processes (e.g., transport, signaling) .

Full-Length vs. Partial Constructs

FeatureFull-Length AF_0105 (Creative BioMart )Partial AF_0105 (Cusabio )
Protein Length1–103 aa (complete transmembrane domain)Partial sequence
Purity>90%>85%
Shelf Life12 months (lyophilized)6–12 months (liquid/lyophilized)

Functional and Pathway Insights

AF_0105 is annotated as a UPF0132 membrane protein, though its precise biochemical role remains understudied. It is implicated in pathways involving:

  • Membrane Transport: Potential involvement in solute or ion transport mechanisms .

  • Signal Transduction: Possible participation in archaeal signaling cascades .

Interacting proteins or cofactors are not explicitly documented in available sources .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your request when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are standardly shipped with normal blue ice packs. Should you require dry ice shipping, kindly contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
During production, the tag type will be determined. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
AF_0105; UPF0132 membrane protein AF_0105
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
AF_0105
Target Protein Sequence
MKENVAGALSYLLGPITGILFLLMEKESQFVKFHAMQSTITFAGFWVLDIALSFIPYIGV LLIPIVGLVAFITWLVCIYKAYSNEWFKLPVVGDIAEQQIGGV
Uniprot No.

Target Background

Database Links

KEGG: afu:AF_0105

STRING: 224325.AF0105

Protein Families
UPF0132 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaeoglobus fulgidus and why is it significant in membrane protein research?

Archaeoglobus fulgidus is a hyperthermophilic archaeon that has been extensively studied for its ability to withstand extreme temperature conditions. It is particularly significant in membrane protein research because its proteins have evolved unique structural and functional properties to maintain stability at high temperatures (approximately 78°C under normal growth conditions) . The study of membrane proteins from this organism provides valuable insights into protein thermostability mechanisms and potential applications in biotechnology where thermostable proteins are advantageous. A. fulgidus belongs to the Euryarchaeota phylum and represents an important model organism for understanding hyperthermophilic adaptation mechanisms .

How is the AF_0105 gene expressed and regulated in native Archaeoglobus fulgidus?

In native Archaeoglobus fulgidus, gene expression is regulated through complex mechanisms that respond to environmental conditions, particularly temperature changes. While specific information about AF_0105 regulation is not directly available in the provided search results, we can infer from studies of heat shock response in A. fulgidus that membrane proteins may be regulated by heat shock regulators such as HSR1 (encoded by AF1298) .

The expression of genes in A. fulgidus involves archaeal transcription machinery that includes TATA boxes and BRE (B Recognition Element) sequences. Regulatory proteins such as HSR1 bind to specific motifs near these elements to control gene expression. For AF_0105, expression would likely be influenced by similar regulatory mechanisms, potentially including the palindromic CTAAC-N5-GTTAG motif identified in heat-responsive genes . Transcription would involve RNA polymerase recruitment through interactions with transcription factors such as TFB, which may be modulated by regulatory proteins under different growth conditions.

What are the structural characteristics of UPF0132 family membrane proteins?

The UPF0132 family of membrane proteins, to which AF_0105 belongs, is characterized by:

  • Multiple transmembrane domains that anchor the protein within the cell membrane

  • Conserved sequence motifs specific to this protein family

  • Potential structural adaptations for thermostability, which may include:

    • Increased hydrophobic interactions within transmembrane regions

    • Enhanced ionic interactions at solvent-exposed surfaces

    • Reduced flexibility in loop regions

    • Higher proportion of amino acids that contribute to structural rigidity

While detailed structural information specifically for AF_0105 is limited in the provided search results, comparative analysis with homologous proteins from mesophilic organisms would likely reveal thermostability-conferring features typical of proteins from hyperthermophiles.

What are the optimal expression systems for recombinant production of AF_0105?

The optimal expression system for recombinant production of AF_0105 would likely follow approaches similar to those used for other A. fulgidus proteins. Based on the search results, successful expression strategies include:

  • E. coli Expression System: The pBAD/HisA vector system (Invitrogen) has been successfully used for expression of A. fulgidus proteins . This system provides:

    • Arabinose-inducible expression

    • N-terminal His-tag for purification

    • Compatibility with thermostable protein expression

  • Expression Protocol Considerations:

    • Codon optimization for E. coli expression may be necessary

    • Lower induction temperatures (25-30°C) despite the thermophilic nature of the protein

    • Extended induction times (8-16 hours) to allow proper folding

    • Addition of rare codon tRNAs through specialized E. coli strains (such as Rosetta)

  • Alternative Expression Systems:

    • Cell-free expression systems may be valuable for membrane proteins like AF_0105

    • Specialized membrane protein expression hosts such as C41(DE3) or C43(DE3) E. coli strains

The choice of expression system should be guided by the intended downstream applications and the need for specific post-translational modifications.

What purification strategies are most effective for recombinant AF_0105?

Based on successful purification of other A. fulgidus proteins, the following purification strategy would likely be effective for recombinant AF_0105:

  • Initial Capture: TALON Superflow resin (BD Biosciences, Clontech) has been successfully used for His-tagged A. fulgidus proteins . This approach provides:

    • High specificity for His-tagged proteins

    • Compatibility with detergent-solubilized membrane proteins

    • Effective recovery under native conditions

  • Membrane Protein-Specific Considerations:

    • Solubilization using appropriate detergents (DDM, LDAO, or OG)

    • Maintaining critical micelle concentration throughout purification

    • Inclusion of glycerol (10-20%) to enhance stability

  • Secondary Purification Steps:

    • Size exclusion chromatography to separate monomeric from aggregated forms

    • Ion exchange chromatography for removal of contaminants

    • Affinity tag removal if required for structural studies

Table 1: Recommended Buffer Compositions for AF_0105 Purification

Purification StepBuffer CompositionPurpose
Cell Lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% DDM, 10% glycerol, protease inhibitorsEfficient membrane solubilization
IMAC Binding50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% DDM, 10% glycerol, 10 mM imidazoleReduce non-specific binding
IMAC Washing50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, 10% glycerol, 20 mM imidazoleRemove loosely bound contaminants
IMAC Elution50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, 10% glycerol, 250 mM imidazoleRecover target protein
Size Exclusion50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDM, 5% glycerolFinal polishing step

How can the thermal stability of recombinant AF_0105 be assessed?

Assessing the thermal stability of recombinant AF_0105 is crucial for verifying proper folding and native-like properties. Recommended methods include:

  • Differential Scanning Calorimetry (DSC):

    • Measures the heat capacity changes during protein unfolding

    • Determines the melting temperature (Tm)

    • Provides thermodynamic parameters of unfolding

  • Circular Dichroism (CD) Spectroscopy:

    • Monitors secondary structure changes with increasing temperature

    • Can be performed at multiple wavelengths (208, 222 nm) to track α-helical content

    • Enables calculation of thermal transition midpoints

  • Thermofluor (Differential Scanning Fluorimetry):

    • Uses fluorescent dyes that bind to hydrophobic regions exposed during unfolding

    • High-throughput capability for screening buffer conditions

    • Lower sample requirements than DSC

  • Activity Assays at Varying Temperatures:

    • Functional tests to determine temperature optimum and activity retention

    • Correlates structural stability with functional integrity

    • Critical for verifying biological relevance of recombinant protein

Given that A. fulgidus grows optimally at approximately 78°C, AF_0105 would be expected to maintain stability and potentially function at temperatures approaching this range .

How does the heat shock response in Archaeoglobus fulgidus affect expression of membrane proteins like AF_0105?

The heat shock response in Archaeoglobus fulgidus involves complex regulatory mechanisms that influence the expression of numerous genes, including potentially membrane proteins like AF_0105. According to microarray analysis, approximately 350 of the 2,410 open reading frames (ORFs) in A. fulgidus exhibit altered expression patterns during heat shock, representing about 14% of the genome .

The heat shock regulator HSR1 (encoded by AF1298) plays a critical role in this response. HSR1 contains a helix-turn-helix (HTH) DNA binding motif and regulates gene expression by binding to specific DNA recognition regions . The mechanism appears to involve negative regulation under normal growth conditions:

  • Under normal growth temperatures (~78°C), HSR1 binds to DNA regulatory regions

  • This binding likely interferes with RNA polymerase interactions with transcription factor B (TFB)

  • At increased temperatures, HSR1 is released from the DNA, allowing transcription to proceed

For membrane proteins like AF_0105, this regulation mechanism could serve to maintain proper membrane composition and function during thermal stress. The expression of membrane proteins might be coordinated with that of chaperones and proteases to ensure proper folding and quality control under heat shock conditions.

A key DNA motif involved in this regulation appears to be the palindromic sequence CTAAC-N5-GTTAG, which is found in the HSR1-protected regions of heat shock-responsive genes . Analysis of the AF_0105 promoter region for this or similar motifs would provide insights into its potential regulation by the heat shock response machinery.

What approaches can be used to study protein-lipid interactions of AF_0105 in hyperthermophilic conditions?

Studying protein-lipid interactions of AF_0105 under hyperthermophilic conditions presents unique technical challenges that require specialized approaches:

  • Native Nanodisc Technology:

    • Incorporation of AF_0105 into nanodiscs with archaeal lipids

    • Thermostable membrane scaffold proteins (MSPs) derived from hyperthermophiles

    • Analysis by electron microscopy and mass spectrometry at elevated temperatures

  • Lipidomic Analysis:

    • Characterization of native A. fulgidus lipids that interact with AF_0105

    • Identification of specific lipid binding sites using photoreactive lipid analogs

    • Determination of lipid composition changes in response to temperature shifts

  • Molecular Dynamics Simulations:

    • In silico modeling of AF_0105 within archaeal membrane environments

    • Simulations at various temperatures to capture dynamic interactions

    • Prediction of lipid-binding sites and conformational changes

  • High-Temperature Solid-State NMR:

    • Analysis of protein-lipid interactions at near-native temperatures

    • Determination of membrane protein orientation and dynamics

    • Identification of specific lipid-protein contacts

Table 2: Specialized Techniques for Studying AF_0105 Protein-Lipid Interactions

TechniqueTemperature RangeInformation ObtainedTechnical Considerations
Native NanodiscsUp to 90°CSpecific lipid associations, structural integrityRequires thermostable MSP variants
Hydrogen-Deuterium Exchange MSUp to 80°CSolvent accessibility, conformational changesModified rapid quenching apparatus
Fluorescence SpectroscopyUp to 100°CBinding kinetics, affinity measurementsHigh-pressure cells to prevent boiling
Cryo-EMSample vitrification from high temperatureHigh-resolution structural informationSpecialized sample preparation protocols

How can contradictions in experimental data regarding AF_0105 function be addressed?

Addressing contradictions in experimental data regarding AF_0105 function requires a systematic approach to identify sources of discrepancy and resolve conflicting results:

  • Methodological Standardization:

    • Implement consistent protein preparation protocols across laboratories

    • Standardize functional assay conditions, including temperature, pH, and buffer composition

    • Develop reference standards for activity measurements

  • Multi-technique Validation:

    • Employ orthogonal techniques to confirm functional assignments

    • Compare results from in vitro reconstitution with whole-cell assays

    • Utilize both biochemical and biophysical approaches to characterize function

  • Genetic Approach:

    • Generate AF_0105 knockout strains to observe phenotypic effects

    • Perform complementation studies with mutant variants

    • Analyze synthetic lethality with related genes

  • Computational Analysis:

    • Apply machine learning algorithms to identify patterns in contradictory datasets

    • Develop predictive models that account for experimental variables

    • Use network analysis to place AF_0105 in functional context

The contradictory dialogue detection methodologies mentioned in search result provide a conceptual framework for thinking about contradiction resolution, though in a different context. Similar principles of identifying supporting evidence and analyzing context can be applied to resolving contradictions in experimental data.

What functional assays are appropriate for characterizing the activity of AF_0105?

Characterizing the activity of AF_0105 requires appropriate functional assays tailored to membrane proteins from hyperthermophiles:

  • Transport Assays:

    • Reconstitution into liposomes for substrate transport measurements

    • Fluorescence-based assays using substrate analogs with temperature-stable fluorophores

    • Radioactive substrate uptake studies in reconstituted systems

  • Binding Assays:

    • Surface plasmon resonance (SPR) with thermostable sensor chips

    • Isothermal titration calorimetry (ITC) adapted for high-temperature measurements

    • Microscale thermophoresis (MST) for detecting interactions at variable temperatures

  • Structural Changes:

    • FRET-based conformational change assays

    • Limited proteolysis at elevated temperatures to identify dynamic regions

    • Crosslinking studies to capture transient conformational states

  • Computational Predictions:

    • Homology modeling based on structurally characterized homologs

    • Virtual screening for potential substrates or binding partners

    • Molecular docking to identify interaction sites

Since the specific function of AF_0105 is not detailed in the search results, these assays would need to be selected and optimized based on bioinformatic predictions of its potential role.

How does the function of AF_0105 compare to homologous proteins in mesophilic organisms?

Comparing the function of AF_0105 to homologous proteins in mesophilic organisms provides insights into evolutionary adaptations for thermostability and potential functional shifts:

  • Comparative Biochemistry:

    • Side-by-side activity assays at varying temperatures

    • Determination of temperature optima and stability profiles

    • Kinetic parameter comparison (Km, kcat, substrate specificity)

  • Structural Comparison:

    • Analysis of amino acid substitutions at functionally important sites

    • Identification of thermostability-enhancing modifications

    • Comparison of flexibility/rigidity in key regions

  • Expression Pattern Analysis:

    • Examination of genetic context and operon structure across species

    • Comparison of regulatory mechanisms in response to environmental stressors

    • Assessment of evolutionary conservation of expression patterns

  • Complementation Studies:

    • Expression of AF_0105 in mesophilic hosts lacking the homologous gene

    • Heterologous expression of mesophilic homologs in A. fulgidus

    • Analysis of functional interchangeability and temperature-dependent effects

Table 3: Comparative Features of Thermophilic vs. Mesophilic Membrane Proteins

FeatureThermophilic Proteins (e.g., AF_0105)Mesophilic HomologsFunctional Implications
Amino Acid CompositionHigher proportion of charged residues on surface; more hydrophobic coreLower surface charge; less hydrophobic coreAffects stability, substrate binding affinity
Loop RegionsShorter, more rigid loopsLonger, more flexible loopsInfluences conformational changes during activity
Disulfide BondsOften increased numberFewer disulfide bondsImpacts stability and temperature optimum
OligomerizationOften higher order structuresMore frequently monomeric or dimericChanges in allosteric regulation and cooperativity
Post-translational ModificationsSpecialized modifications for thermostabilityStandard modificationsPotential differences in regulation mechanisms

What role might AF_0105 play in the DNA repair mechanisms of Archaeoglobus fulgidus?

While AF_0105 is not specifically mentioned in connection with DNA repair in the search results, we can explore potential connections based on the known DNA repair mechanisms in A. fulgidus:

  • Potential Membrane-Associated DNA Repair:

    • AF_0105 might function in membrane-associated DNA repair complexes

    • Could be involved in maintaining membrane integrity during thermal stress

    • May participate in signaling pathways related to DNA damage response

  • Base Excision Repair (BER) System:

    • A. fulgidus possesses a BER system for repairing cytosine deamination damage

    • While using a family 4 uracil-DNA glycosylase (UDG), A. fulgidus employs a β-elimination mechanism rather than a hydrolytic mechanism

    • AF_0105 could potentially be involved in the membrane-associated aspects of this process

  • Connection to Heat Shock Response:

    • DNA repair mechanisms are often coordinated with heat shock responses

    • As discussed in section 4.1, heat shock regulation in A. fulgidus involves proteins like HSR1

    • AF_0105 might be co-regulated with DNA repair systems under heat stress conditions

  • ATP/ADP Utilization:

    • DNA repair in A. fulgidus shows interesting energy requirements, with repair product formation stimulated by both ATP and ADP

    • If AF_0105 has transporter or energy-coupling functions, it might influence nucleotide availability for repair processes

To definitively establish AF_0105's role in DNA repair, targeted experiments would be needed, such as protein-protein interaction studies with known repair components, localization studies during DNA damage, and phenotypic analysis of AF_0105 mutants under DNA-damaging conditions.

What emerging technologies could advance our understanding of AF_0105 structure and function?

Several emerging technologies hold promise for advancing our understanding of AF_0105:

  • Cryo-EM for Membrane Proteins:

    • Recent advances in cryo-EM have revolutionized membrane protein structural biology

    • Application of methods like graphene oxide supports and new detergents

    • Potential for high-resolution structures without crystallization

  • Native Mass Spectrometry:

    • Development of methods compatible with extreme thermophiles

    • Analysis of intact membrane protein complexes

    • Determination of binding partners and stoichiometry

  • Single-Molecule Techniques:

    • FRET-based approaches for conformational dynamics

    • High-temperature adaptations of optical tweezers

    • Nanopore-based functional assays

  • AI-Powered Structure Prediction:

    • Application of AlphaFold2 and RoseTTAFold to archaeal membrane proteins

    • Integration of sparse experimental data with prediction algorithms

    • Development of specialized models for hyperthermophilic proteins

  • Genome Editing in Archaea:

    • CRISPR-Cas systems adapted for Archaeoglobus fulgidus

    • Site-directed mutagenesis for structure-function studies

    • Creation of reporter systems for in vivo localization and interaction studies

How might research on AF_0105 contribute to our understanding of extremophile adaptation?

Research on AF_0105 has significant potential to enhance our understanding of extremophile adaptation:

  • Membrane Biophysics Under Extreme Conditions:

    • Insights into membrane fluidity regulation at high temperatures

    • Understanding of lipid-protein interactions in archaea

    • Mechanisms for maintaining ion gradients under thermal stress

  • Evolutionary Insights:

    • Comparative genomics across extremophiles with AF_0105 homologs

    • Tracing the evolution of membrane protein adaptations

    • Identification of convergent adaptations in unrelated extremophiles

  • Biotechnology Applications:

    • Development of thermostable membrane protein expression systems

    • Engineering of membrane proteins with enhanced stability

    • Design principles for proteins functioning in extreme environments

  • Astrobiology Implications:

    • Models for potential membrane functions in extraterrestrial environments

    • Understanding the limits of biological membrane function

    • Insights into early evolution in extreme environments on Earth

What computational approaches can predict interactions between AF_0105 and other cellular components?

Advanced computational approaches can help predict interactions between AF_0105 and other cellular components:

  • Protein-Protein Interaction Prediction:

    • Deep learning models trained on archaeal interactomes

    • Coevolutionary analysis to identify potential interaction partners

    • Molecular docking with archaeal protein structures

  • Integrative Modeling:

    • Combination of structural predictions with experimental data

    • Systems biology approaches incorporating metabolic and regulatory networks

    • Multi-scale modeling from atomic to cellular levels

  • Specialized Tools for Archaeal Membrane Proteins:

    • Adapted topology prediction algorithms for archaeal membrane proteins

    • Specialized force fields for molecular dynamics simulations

    • Tools accounting for the unique lipid composition of archaeal membranes

  • Network Analysis:

    • Construction of functional association networks

    • Identification of AF_0105's position in stress response networks

    • Prediction of phenotypic effects of AF_0105 perturbation

Table 4: Computational Tools Relevant for AF_0105 Analysis

Tool CategoryExample ToolsApplication to AF_0105Limitations
Structure PredictionAlphaFold2, RoseTTAFoldPredicting 3D structureLimited training data for archaeal membrane proteins
Molecular DynamicsGROMACS, NAMD with specialized archaeal parametersSimulating behavior at high temperaturesComputational cost for extended simulations
Interactome AnalysisSTRING-db, archaeal-specific datasetsPredicting functional partnersLimited experimental data for validation
Systems BiologyConstraint-based modeling, archaeal metabolic modelsPlacing AF_0105 in cellular contextIncomplete knowledge of archaeal biochemistry

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.