AF_0105 is a recombinant UPF0132 family membrane protein fused with an N-terminal His tag for efficient purification. Its full-length sequence (1–103 aa) includes the complete transmembrane domain critical for studying membrane-protein interactions and stability . The protein is lyophilized or provided in a Tris-based buffer with trehalose or glycerol for optimal stability .
| Parameter | Value/Description |
|---|---|
| Source Organism | Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304) |
| Host System | E. coli |
| Tag | N-terminal His tag |
| Protein Length | Full-length (1–103 aa) |
| UniProt ID | O30131 |
| Gene Name | AF_0105 |
The primary sequence of AF_0105 is:
MKENVAGALSYLLGPITGILFLLMEKESQFVKFHAMQSTITFAGFWVLDIALSFIPYIGVLLIPIVGLVAFITWLVCIYKAYSNEWFKLPVVGDIAEQQIGGV .
While specific functional studies are not detailed in available sources, AF_0105 is utilized in:
Structural Biology: Studying archaeal membrane protein folding and stability .
ELISA Kits: As an antigen in immunoassays (e.g., Anagnostics’ ELISA kit for detection) .
Pathway Analysis: Investigating UPF0132 family protein roles in membrane-associated processes (e.g., transport, signaling) .
AF_0105 is annotated as a UPF0132 membrane protein, though its precise biochemical role remains understudied. It is implicated in pathways involving:
Membrane Transport: Potential involvement in solute or ion transport mechanisms .
Signal Transduction: Possible participation in archaeal signaling cascades .
Interacting proteins or cofactors are not explicitly documented in available sources .
KEGG: afu:AF_0105
STRING: 224325.AF0105
Archaeoglobus fulgidus is a hyperthermophilic archaeon that has been extensively studied for its ability to withstand extreme temperature conditions. It is particularly significant in membrane protein research because its proteins have evolved unique structural and functional properties to maintain stability at high temperatures (approximately 78°C under normal growth conditions) . The study of membrane proteins from this organism provides valuable insights into protein thermostability mechanisms and potential applications in biotechnology where thermostable proteins are advantageous. A. fulgidus belongs to the Euryarchaeota phylum and represents an important model organism for understanding hyperthermophilic adaptation mechanisms .
In native Archaeoglobus fulgidus, gene expression is regulated through complex mechanisms that respond to environmental conditions, particularly temperature changes. While specific information about AF_0105 regulation is not directly available in the provided search results, we can infer from studies of heat shock response in A. fulgidus that membrane proteins may be regulated by heat shock regulators such as HSR1 (encoded by AF1298) .
The expression of genes in A. fulgidus involves archaeal transcription machinery that includes TATA boxes and BRE (B Recognition Element) sequences. Regulatory proteins such as HSR1 bind to specific motifs near these elements to control gene expression. For AF_0105, expression would likely be influenced by similar regulatory mechanisms, potentially including the palindromic CTAAC-N5-GTTAG motif identified in heat-responsive genes . Transcription would involve RNA polymerase recruitment through interactions with transcription factors such as TFB, which may be modulated by regulatory proteins under different growth conditions.
The UPF0132 family of membrane proteins, to which AF_0105 belongs, is characterized by:
Multiple transmembrane domains that anchor the protein within the cell membrane
Conserved sequence motifs specific to this protein family
Potential structural adaptations for thermostability, which may include:
Increased hydrophobic interactions within transmembrane regions
Enhanced ionic interactions at solvent-exposed surfaces
Reduced flexibility in loop regions
Higher proportion of amino acids that contribute to structural rigidity
While detailed structural information specifically for AF_0105 is limited in the provided search results, comparative analysis with homologous proteins from mesophilic organisms would likely reveal thermostability-conferring features typical of proteins from hyperthermophiles.
The optimal expression system for recombinant production of AF_0105 would likely follow approaches similar to those used for other A. fulgidus proteins. Based on the search results, successful expression strategies include:
E. coli Expression System: The pBAD/HisA vector system (Invitrogen) has been successfully used for expression of A. fulgidus proteins . This system provides:
Arabinose-inducible expression
N-terminal His-tag for purification
Compatibility with thermostable protein expression
Expression Protocol Considerations:
Codon optimization for E. coli expression may be necessary
Lower induction temperatures (25-30°C) despite the thermophilic nature of the protein
Extended induction times (8-16 hours) to allow proper folding
Addition of rare codon tRNAs through specialized E. coli strains (such as Rosetta)
Alternative Expression Systems:
Cell-free expression systems may be valuable for membrane proteins like AF_0105
Specialized membrane protein expression hosts such as C41(DE3) or C43(DE3) E. coli strains
The choice of expression system should be guided by the intended downstream applications and the need for specific post-translational modifications.
Based on successful purification of other A. fulgidus proteins, the following purification strategy would likely be effective for recombinant AF_0105:
Initial Capture: TALON Superflow resin (BD Biosciences, Clontech) has been successfully used for His-tagged A. fulgidus proteins . This approach provides:
High specificity for His-tagged proteins
Compatibility with detergent-solubilized membrane proteins
Effective recovery under native conditions
Membrane Protein-Specific Considerations:
Solubilization using appropriate detergents (DDM, LDAO, or OG)
Maintaining critical micelle concentration throughout purification
Inclusion of glycerol (10-20%) to enhance stability
Secondary Purification Steps:
Size exclusion chromatography to separate monomeric from aggregated forms
Ion exchange chromatography for removal of contaminants
Affinity tag removal if required for structural studies
Table 1: Recommended Buffer Compositions for AF_0105 Purification
| Purification Step | Buffer Composition | Purpose |
|---|---|---|
| Cell Lysis | 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% DDM, 10% glycerol, protease inhibitors | Efficient membrane solubilization |
| IMAC Binding | 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% DDM, 10% glycerol, 10 mM imidazole | Reduce non-specific binding |
| IMAC Washing | 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, 10% glycerol, 20 mM imidazole | Remove loosely bound contaminants |
| IMAC Elution | 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, 10% glycerol, 250 mM imidazole | Recover target protein |
| Size Exclusion | 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDM, 5% glycerol | Final polishing step |
Assessing the thermal stability of recombinant AF_0105 is crucial for verifying proper folding and native-like properties. Recommended methods include:
Differential Scanning Calorimetry (DSC):
Measures the heat capacity changes during protein unfolding
Determines the melting temperature (Tm)
Provides thermodynamic parameters of unfolding
Circular Dichroism (CD) Spectroscopy:
Monitors secondary structure changes with increasing temperature
Can be performed at multiple wavelengths (208, 222 nm) to track α-helical content
Enables calculation of thermal transition midpoints
Thermofluor (Differential Scanning Fluorimetry):
Uses fluorescent dyes that bind to hydrophobic regions exposed during unfolding
High-throughput capability for screening buffer conditions
Lower sample requirements than DSC
Activity Assays at Varying Temperatures:
Functional tests to determine temperature optimum and activity retention
Correlates structural stability with functional integrity
Critical for verifying biological relevance of recombinant protein
Given that A. fulgidus grows optimally at approximately 78°C, AF_0105 would be expected to maintain stability and potentially function at temperatures approaching this range .
The heat shock response in Archaeoglobus fulgidus involves complex regulatory mechanisms that influence the expression of numerous genes, including potentially membrane proteins like AF_0105. According to microarray analysis, approximately 350 of the 2,410 open reading frames (ORFs) in A. fulgidus exhibit altered expression patterns during heat shock, representing about 14% of the genome .
The heat shock regulator HSR1 (encoded by AF1298) plays a critical role in this response. HSR1 contains a helix-turn-helix (HTH) DNA binding motif and regulates gene expression by binding to specific DNA recognition regions . The mechanism appears to involve negative regulation under normal growth conditions:
Under normal growth temperatures (~78°C), HSR1 binds to DNA regulatory regions
This binding likely interferes with RNA polymerase interactions with transcription factor B (TFB)
At increased temperatures, HSR1 is released from the DNA, allowing transcription to proceed
For membrane proteins like AF_0105, this regulation mechanism could serve to maintain proper membrane composition and function during thermal stress. The expression of membrane proteins might be coordinated with that of chaperones and proteases to ensure proper folding and quality control under heat shock conditions.
A key DNA motif involved in this regulation appears to be the palindromic sequence CTAAC-N5-GTTAG, which is found in the HSR1-protected regions of heat shock-responsive genes . Analysis of the AF_0105 promoter region for this or similar motifs would provide insights into its potential regulation by the heat shock response machinery.
Studying protein-lipid interactions of AF_0105 under hyperthermophilic conditions presents unique technical challenges that require specialized approaches:
Native Nanodisc Technology:
Incorporation of AF_0105 into nanodiscs with archaeal lipids
Thermostable membrane scaffold proteins (MSPs) derived from hyperthermophiles
Analysis by electron microscopy and mass spectrometry at elevated temperatures
Lipidomic Analysis:
Characterization of native A. fulgidus lipids that interact with AF_0105
Identification of specific lipid binding sites using photoreactive lipid analogs
Determination of lipid composition changes in response to temperature shifts
Molecular Dynamics Simulations:
In silico modeling of AF_0105 within archaeal membrane environments
Simulations at various temperatures to capture dynamic interactions
Prediction of lipid-binding sites and conformational changes
High-Temperature Solid-State NMR:
Analysis of protein-lipid interactions at near-native temperatures
Determination of membrane protein orientation and dynamics
Identification of specific lipid-protein contacts
Table 2: Specialized Techniques for Studying AF_0105 Protein-Lipid Interactions
| Technique | Temperature Range | Information Obtained | Technical Considerations |
|---|---|---|---|
| Native Nanodiscs | Up to 90°C | Specific lipid associations, structural integrity | Requires thermostable MSP variants |
| Hydrogen-Deuterium Exchange MS | Up to 80°C | Solvent accessibility, conformational changes | Modified rapid quenching apparatus |
| Fluorescence Spectroscopy | Up to 100°C | Binding kinetics, affinity measurements | High-pressure cells to prevent boiling |
| Cryo-EM | Sample vitrification from high temperature | High-resolution structural information | Specialized sample preparation protocols |
Addressing contradictions in experimental data regarding AF_0105 function requires a systematic approach to identify sources of discrepancy and resolve conflicting results:
Methodological Standardization:
Implement consistent protein preparation protocols across laboratories
Standardize functional assay conditions, including temperature, pH, and buffer composition
Develop reference standards for activity measurements
Multi-technique Validation:
Employ orthogonal techniques to confirm functional assignments
Compare results from in vitro reconstitution with whole-cell assays
Utilize both biochemical and biophysical approaches to characterize function
Genetic Approach:
Generate AF_0105 knockout strains to observe phenotypic effects
Perform complementation studies with mutant variants
Analyze synthetic lethality with related genes
Computational Analysis:
Apply machine learning algorithms to identify patterns in contradictory datasets
Develop predictive models that account for experimental variables
Use network analysis to place AF_0105 in functional context
The contradictory dialogue detection methodologies mentioned in search result provide a conceptual framework for thinking about contradiction resolution, though in a different context. Similar principles of identifying supporting evidence and analyzing context can be applied to resolving contradictions in experimental data.
Characterizing the activity of AF_0105 requires appropriate functional assays tailored to membrane proteins from hyperthermophiles:
Transport Assays:
Reconstitution into liposomes for substrate transport measurements
Fluorescence-based assays using substrate analogs with temperature-stable fluorophores
Radioactive substrate uptake studies in reconstituted systems
Binding Assays:
Surface plasmon resonance (SPR) with thermostable sensor chips
Isothermal titration calorimetry (ITC) adapted for high-temperature measurements
Microscale thermophoresis (MST) for detecting interactions at variable temperatures
Structural Changes:
FRET-based conformational change assays
Limited proteolysis at elevated temperatures to identify dynamic regions
Crosslinking studies to capture transient conformational states
Computational Predictions:
Homology modeling based on structurally characterized homologs
Virtual screening for potential substrates or binding partners
Molecular docking to identify interaction sites
Since the specific function of AF_0105 is not detailed in the search results, these assays would need to be selected and optimized based on bioinformatic predictions of its potential role.
Comparing the function of AF_0105 to homologous proteins in mesophilic organisms provides insights into evolutionary adaptations for thermostability and potential functional shifts:
Comparative Biochemistry:
Side-by-side activity assays at varying temperatures
Determination of temperature optima and stability profiles
Kinetic parameter comparison (Km, kcat, substrate specificity)
Structural Comparison:
Analysis of amino acid substitutions at functionally important sites
Identification of thermostability-enhancing modifications
Comparison of flexibility/rigidity in key regions
Expression Pattern Analysis:
Examination of genetic context and operon structure across species
Comparison of regulatory mechanisms in response to environmental stressors
Assessment of evolutionary conservation of expression patterns
Complementation Studies:
Expression of AF_0105 in mesophilic hosts lacking the homologous gene
Heterologous expression of mesophilic homologs in A. fulgidus
Analysis of functional interchangeability and temperature-dependent effects
Table 3: Comparative Features of Thermophilic vs. Mesophilic Membrane Proteins
| Feature | Thermophilic Proteins (e.g., AF_0105) | Mesophilic Homologs | Functional Implications |
|---|---|---|---|
| Amino Acid Composition | Higher proportion of charged residues on surface; more hydrophobic core | Lower surface charge; less hydrophobic core | Affects stability, substrate binding affinity |
| Loop Regions | Shorter, more rigid loops | Longer, more flexible loops | Influences conformational changes during activity |
| Disulfide Bonds | Often increased number | Fewer disulfide bonds | Impacts stability and temperature optimum |
| Oligomerization | Often higher order structures | More frequently monomeric or dimeric | Changes in allosteric regulation and cooperativity |
| Post-translational Modifications | Specialized modifications for thermostability | Standard modifications | Potential differences in regulation mechanisms |
While AF_0105 is not specifically mentioned in connection with DNA repair in the search results, we can explore potential connections based on the known DNA repair mechanisms in A. fulgidus:
Potential Membrane-Associated DNA Repair:
AF_0105 might function in membrane-associated DNA repair complexes
Could be involved in maintaining membrane integrity during thermal stress
May participate in signaling pathways related to DNA damage response
Base Excision Repair (BER) System:
Connection to Heat Shock Response:
ATP/ADP Utilization:
To definitively establish AF_0105's role in DNA repair, targeted experiments would be needed, such as protein-protein interaction studies with known repair components, localization studies during DNA damage, and phenotypic analysis of AF_0105 mutants under DNA-damaging conditions.
Several emerging technologies hold promise for advancing our understanding of AF_0105:
Cryo-EM for Membrane Proteins:
Recent advances in cryo-EM have revolutionized membrane protein structural biology
Application of methods like graphene oxide supports and new detergents
Potential for high-resolution structures without crystallization
Native Mass Spectrometry:
Development of methods compatible with extreme thermophiles
Analysis of intact membrane protein complexes
Determination of binding partners and stoichiometry
Single-Molecule Techniques:
FRET-based approaches for conformational dynamics
High-temperature adaptations of optical tweezers
Nanopore-based functional assays
AI-Powered Structure Prediction:
Application of AlphaFold2 and RoseTTAFold to archaeal membrane proteins
Integration of sparse experimental data with prediction algorithms
Development of specialized models for hyperthermophilic proteins
Genome Editing in Archaea:
CRISPR-Cas systems adapted for Archaeoglobus fulgidus
Site-directed mutagenesis for structure-function studies
Creation of reporter systems for in vivo localization and interaction studies
Research on AF_0105 has significant potential to enhance our understanding of extremophile adaptation:
Membrane Biophysics Under Extreme Conditions:
Insights into membrane fluidity regulation at high temperatures
Understanding of lipid-protein interactions in archaea
Mechanisms for maintaining ion gradients under thermal stress
Evolutionary Insights:
Comparative genomics across extremophiles with AF_0105 homologs
Tracing the evolution of membrane protein adaptations
Identification of convergent adaptations in unrelated extremophiles
Biotechnology Applications:
Development of thermostable membrane protein expression systems
Engineering of membrane proteins with enhanced stability
Design principles for proteins functioning in extreme environments
Astrobiology Implications:
Models for potential membrane functions in extraterrestrial environments
Understanding the limits of biological membrane function
Insights into early evolution in extreme environments on Earth
Advanced computational approaches can help predict interactions between AF_0105 and other cellular components:
Protein-Protein Interaction Prediction:
Deep learning models trained on archaeal interactomes
Coevolutionary analysis to identify potential interaction partners
Molecular docking with archaeal protein structures
Integrative Modeling:
Combination of structural predictions with experimental data
Systems biology approaches incorporating metabolic and regulatory networks
Multi-scale modeling from atomic to cellular levels
Specialized Tools for Archaeal Membrane Proteins:
Adapted topology prediction algorithms for archaeal membrane proteins
Specialized force fields for molecular dynamics simulations
Tools accounting for the unique lipid composition of archaeal membranes
Network Analysis:
Construction of functional association networks
Identification of AF_0105's position in stress response networks
Prediction of phenotypic effects of AF_0105 perturbation
Table 4: Computational Tools Relevant for AF_0105 Analysis
| Tool Category | Example Tools | Application to AF_0105 | Limitations |
|---|---|---|---|
| Structure Prediction | AlphaFold2, RoseTTAFold | Predicting 3D structure | Limited training data for archaeal membrane proteins |
| Molecular Dynamics | GROMACS, NAMD with specialized archaeal parameters | Simulating behavior at high temperatures | Computational cost for extended simulations |
| Interactome Analysis | STRING-db, archaeal-specific datasets | Predicting functional partners | Limited experimental data for validation |
| Systems Biology | Constraint-based modeling, archaeal metabolic models | Placing AF_0105 in cellular context | Incomplete knowledge of archaeal biochemistry |