Recombinant Archaeoglobus fulgidus UPF0290 protein AF_1740 (AF_1740)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant AF_1740 is produced in heterologous expression systems, including Escherichia coli and mammalian cells, with variants available as partial-length proteins . Key properties include:

ParameterDetails
Uniprot IDO28534
Protein LengthPartial sequence (residues 1–179)
TagUndisclosed; determined during production
Purity>85% (SDS-PAGE)
Storage-20°C or -80°C in Tris-based buffer with 50% glycerol
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week

The amino acid sequence includes conserved motifs such as mLDLILKTIWLLLPCYTPNNFAVLVGGGTPIDFGKTFVDGKRILGDGKTWRGFVGGVAGG... .

Functional and Research Applications

AF_1740’s recombinant form is primarily utilized for:

  • Enzymatic Assays: Proteins like Pol-D are studied for DNA replication fidelity and inhibition by deaminated bases (e.g., hypoxanthine and uracil) . AF_1740’s potential role in nucleic acid metabolism remains speculative.

  • Structural Biology: Recombinant proteins from A. fulgidus are often used for crystallography due to their thermostability .

  • Biotechnological Tool Development: Archaeal proteins are leveraged for industrial applications, such as DNA polymerases in PCR .

Current Research Gaps and Future Directions

  • Functional Annotation: AF_1740’s biological role is uncharacterized. Homology modeling or mutagenesis studies (e.g., targeting conserved motifs like GYPL in related AAA proteins ) could clarify its activity.

  • Interaction Networks: No data exist on AF_1740’s binding partners or regulatory pathways.

  • Industrial Potential: Thermophilic proteins like AfFtn are engineered for nanotechnology ; AF_1740’s stability may suit similar applications.

Key Challenges

  • Sequence Completeness: Available recombinant AF_1740 is partial-length, limiting functional studies .

  • Absence of In Vivo Data: Most insights derive from in vitro studies of related proteins .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
carS; AF_1740; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Target Names
carS
Target Protein Sequence
MLDLILKTIWLLLPCYTPNNFAVLVGGGTPIDFGKTFVDGKRILGDGKTWRGFVGGVAGG VLTANLQYAIEKLSGLAIYSSLPFNEFFTLTFLLAFGAMFGDLCGSFIKRRFGYERGSRF LIVDQLMFLLVALLIASLYPPFWKLFTAEIIALAVIITPALHMGINYIAYRLNLKEVPW
Uniprot No.

Target Background

Function
This protein catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction constitutes the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids. It can utilize CTP or dCTP, but not ATP, GTP, or TTP.
Database Links

KEGG: afu:AF_1740

STRING: 224325.AF1740

Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does AF_1740 protein compare structurally to other archaeal membrane proteins?

When comparing AF_1740 to other archaeal membrane proteins, several distinctive features emerge. Unlike many heme-containing archaeal proteins such as those found in Haloferax volcanii that utilize the traditional cysteine pair paradigm for heme attachment, AF_1740 appears to employ a different structural arrangement .

The protein contains three histidine residues within its sequence, which may participate in coordination chemistry with metal ions or other prosthetic groups. This contrasts with the covalent heme attachment mechanism observed in haloarchaeal proteins like the SdhD subunit in Natronomonas, where a novel mode of heme attachment has been proposed .

The transmembrane topology of AF_1740 appears to follow patterns seen in other archaeal membrane proteins, with hydrophobic α-helical segments traversing the unique archaeal lipid bilayer. This arrangement would be compatible with the ether-linked isoprenoid lipids characteristic of archaeal membranes, as opposed to the ester-linked fatty acid lipids found in bacteria and eukaryotes .

FeatureAF_1740Typical Bacterial Membrane ProteinsOther Archaeal Membrane Proteins
Amino acid compositionRich in hydrophobic residuesSimilar hydrophobic patternsSimilar but adapted to extreme conditions
Metal coordinationPotential His-based coordinationOften Cys-basedVariable, with novel mechanisms
Membrane interactionAdapted to archaeal ether lipidsAdapted to bacterial ester lipidsSimilar adaptation to archaeal lipids
Thermal stabilityHigh (hyperthermophile)Generally lowerVariable depending on species

What are the optimal expression systems for producing recombinant AF_1740 protein?

For efficient expression of recombinant Archaeoglobus fulgidus UPF0290 protein AF_1740, several expression systems have been evaluated with varying degrees of success. The optimal approach involves balancing protein yield, proper folding, and preservation of native structure.

Escherichia coli-based expression systems remain the most commonly used platform due to their simplicity and scalability. When expressing AF_1740, considerations for its hyperthermophilic origin are crucial. Most successful protocols employ the following methodology:

  • Selection of specialized E. coli strains (BL21(DE3) Rosetta or C41/C43) that are optimized for membrane protein expression

  • Use of expression vectors with tightly controlled promoters (T7 lac or arabinose-inducible systems)

  • Co-expression with archaeal chaperones when possible

  • Growth at lower temperatures (16-20°C) after induction to enhance proper folding

  • Supplementation with rare codons frequently used in archaeal genes

For membrane proteins like AF_1740, cell-free expression systems have shown promising results, particularly when combined with detergent micelles or nanodiscs to facilitate proper folding of transmembrane domains. These systems circumvent toxicity issues that often plague heterologous expression of membrane proteins in living cells.

An emerging alternative is the use of archaeal expression hosts like Haloferax volcanii, which provide a more native-like environment for protein folding and post-translational modifications. While technically more challenging, this approach may be necessary when authentic archaeal lipid interactions are essential for functional studies .

What purification challenges are specific to AF_1740, and how can they be addressed?

Purification of recombinant Archaeoglobus fulgidus UPF0290 protein AF_1740 presents several challenges specific to archaeal membrane proteins. Researchers should implement the following methodological approaches to overcome these obstacles:

Challenge 1: Membrane extraction and solubilization
AF_1740's hydrophobic nature necessitates careful selection of detergents for efficient extraction. A systematic screening approach is recommended:

  • Begin with mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations 2-3× above their critical micelle concentration

  • For particularly recalcitrant preparations, stronger detergents like lauryldimethylamine oxide (LDAO) may be necessary

  • Monitor protein stability using circular dichroism or fluorescence spectroscopy across detergent conditions

  • Consider native archaeal lipid extracts as additives to maintain protein stability

Challenge 2: Maintaining protein stability during purification
AF_1740 may require specific buffer conditions reflecting its hyperthermophilic origin:

  • Utilize buffers containing 300-500 mM NaCl to mimic intracellular salt concentrations

  • Maintain an acidic to neutral pH range (pH 5.5-7.0)

  • Include glycerol (10-20%) or trehalose as stabilizing agents

  • Perform chromatography steps at elevated temperatures (30-45°C) when possible

Challenge 3: Affinity tag interference
The choice and placement of affinity tags can significantly impact protein function:

  • C-terminal tags are often preferable to N-terminal ones for AF_1740, as they minimize interference with signal sequences

  • Cleavable tags with specific protease sites allow tag removal post-purification

  • For LC-MS analysis, protocols similar to those described for archaeal lipid research can be adapted for protein characterization

By addressing these specific challenges, researchers can improve both yield and quality of purified AF_1740 protein for downstream structural and functional analyses.

What methods are most effective for determining the membrane topology of AF_1740?

Determining the membrane topology of Archaeoglobus fulgidus UPF0290 protein AF_1740 requires specialized techniques that can accurately map transmembrane domains and their orientation. Based on approaches used for similar proteins, the following methodological framework is recommended:

pH-sensitive fluorescent protein fusions:
Similar to the approach described for plant membrane proteins , strategically inserting pH-sensitive variants of fluorescent proteins (such as YFP) into predicted hydrophilic loops can determine orientation:

  • Insert YFP into putative loops between transmembrane domains

  • Express in a model system with a steep pH gradient across membranes

  • Monitor fluorescence under varying pH conditions

  • Absence of fluorescence in acidic conditions suggests an extracellular/periplasmic location, while maintained fluorescence indicates cytoplasmic positioning

Cysteine scanning mutagenesis:
This powerful approach involves:

  • Creating a cysteine-free version of AF_1740 as a background

  • Introducing individual cysteines at positions throughout the protein

  • Treating intact cells with membrane-impermeable sulfhydryl reagents

  • Identifying labeled positions via mass spectrometry

  • Positions accessible to labeling are located on the external face of the membrane

Protease protection assays:
This complementary method provides additional topology information:

  • Create epitope-tagged constructs of AF_1740

  • Prepare inside-out and right-side-out membrane vesicles

  • Treat with proteases of different specificities

  • Analyze proteolytic fragments using immunoblotting

  • Protected fragments indicate domains shielded by the membrane

By integrating data from these complementary approaches, researchers can build a confident model of AF_1740's membrane topology that accounts for the unique properties of archaeal membranes.

How can researchers investigate potential protein-protein interactions involving AF_1740?

Investigating protein-protein interactions (PPIs) involving Archaeoglobus fulgidus UPF0290 protein AF_1740 requires specialized approaches suitable for membrane proteins from extremophilic archaea. The following methodological framework provides a comprehensive strategy:

Co-expression and co-purification strategies:

  • Design dual expression constructs with AF_1740 and potential interacting partners

  • Utilize orthogonal affinity tags (His-tag for AF_1740, alternative tag for partner)

  • Perform tandem affinity purification to isolate intact complexes

  • Verify interactions by immunoblotting and mass spectrometry

Membrane-based two-hybrid systems:
Traditional yeast two-hybrid systems are unsuitable for membrane proteins. Instead:

  • Implement specialized membrane yeast two-hybrid (MYTH) or bacterial two-hybrid systems

  • Design split-ubiquitin constructs for AF_1740 and candidate interactors

  • Screen against genomic libraries from Archaeoglobus fulgidus

  • Validate hits with reciprocal constructs and quantitative reporter assays

In situ crosslinking and mass spectrometry:
This approach captures transient interactions in near-native conditions:

  • Treat intact cells or membrane preparations with membrane-permeable crosslinkers

  • Solubilize and purify AF_1740 under denaturing conditions

  • Perform tryptic digestion and analyze cross-linked peptides by LC-MS/MS

  • Identify crosslinked partners using specialized search algorithms

Co-expression network analysis:
Similar to the approach used for atrial fibrillation risk genes , co-expression analysis can identify functional relationships:

  • Analyze transcriptomic data from Archaeoglobus fulgidus under various conditions

  • Identify genes with expression patterns correlating with AF_1740

  • Apply weighted gene co-expression network analysis (WGCNA) to identify modules

  • Prioritize candidates from the same module for biochemical validation

For the most robust results, integration of data from multiple approaches is essential, particularly for archaeal membrane proteins where conventional interaction methods often fail.

How might AF_1740 contribute to our understanding of archaeal membrane adaptations to extreme environments?

Archaeoglobus fulgidus UPF0290 protein AF_1740 represents a valuable model system for investigating archaeal membrane adaptations to extreme environments. As a membrane protein from a hyperthermophilic archaeon that thrives at temperatures up to 95°C, AF_1740 likely embodies specialized structural and functional adaptations that contribute to membrane stability under these extreme conditions.

Thermostability mechanisms:
Research with AF_1740 can illuminate molecular adaptations conferring thermostability:

  • Analysis of amino acid composition reveals an abundance of charged residues forming salt bridges and hydrophobic amino acids in transmembrane regions

  • These features likely contribute to structural rigidity at high temperatures while maintaining necessary conformational flexibility for function

  • Comparison with mesophilic homologs (when identified) can highlight specific residues contributing to thermostability

  • Mutagenesis studies targeting these residues would provide experimental validation

Membrane interaction specificity:
AF_1740's interactions with archaeal lipids provide insights into domain-specific adaptations:

  • Archaeal membranes contain unique ether-linked isoprenoid lipids rather than ester-linked fatty acids found in bacteria and eukaryotes

  • Studies investigating AF_1740's lipid preferences could reveal specific lipid-protein interactions that maintain membrane integrity under extreme conditions

  • Reconstitution experiments in liposomes with varying lipid compositions can test functional dependence on specific archaeal lipids

Evolutionary implications:
Comparative analysis of AF_1740 with proteins from other domains provides evolutionary insights:

  • The protein's uniqueness highlights the divergent evolution of membrane systems across domains of life

  • As noted in discussions of other archaeal proteins, there may be "paradigm shifts" required in understanding how these proteins function compared to bacterial counterparts

  • Potential horizontal gene transfer events involving AF_1740 or related genes could be identified through phylogenetic analysis

By thoroughly characterizing AF_1740's structure, function, and interactions, researchers can gain broader insights into the molecular basis of archaeal adaptation to extreme environments, with potential applications in biotechnology and evolutionary biology.

What approaches can be used to determine if AF_1740 contains bound cofactors or prosthetic groups?

Determining whether Archaeoglobus fulgidus UPF0290 protein AF_1740 contains bound cofactors or prosthetic groups requires a systematic analytical approach combining spectroscopic, biochemical, and structural methods. Based on strategies applied to other archaeal proteins, the following methodological framework is recommended:

UV-visible spectroscopy screening:

  • Scan purified AF_1740 across wavelengths from 250-700 nm

  • Compare spectra in native and denatured states

  • Look for characteristic absorption peaks that might indicate:

    • Flavin groups (peaks at ~370 and ~450 nm)

    • Heme groups (Soret band at ~400 nm, as observed in archaeal cytochromes)

    • Iron-sulfur clusters (broad absorbance in the 400-500 nm region)

  • Analyze spectra under different redox conditions using oxidants and reductants

Metal content analysis:

  • Perform inductively coupled plasma mass spectrometry (ICP-MS) on purified protein

  • Quantify metal:protein stoichiometry for common cofactor metals (Fe, Cu, Zn, Ni, Mo)

  • Include appropriate controls (buffer only, metal-free protein)

  • For suspected heme groups, use the pyridine hemochromogen assay to confirm and quantify

Protein mass spectrometry approaches:

  • Compare theoretical mass from amino acid sequence with observed mass

  • Mass differences may indicate presence of covalently attached prosthetic groups

  • For potential heme attachments, look for modifications at histidine residues, as these may be involved in novel attachment mechanisms distinct from the traditional cysteine pair paradigm

  • Use tandem MS/MS to identify modified peptides and localize attachment sites

Crystallographic and spectroscopic structural analysis:

  • If X-ray crystallography is possible, electron density maps can directly visualize cofactors

  • Alternatively, use resonance Raman spectroscopy for identification of specific prosthetic groups

  • EPR spectroscopy can characterize paramagnetic centers in potential cofactors

  • For binding site prediction, computational docking can suggest potential cofactor locations

Functional loss/restoration assays:

  • Attempt to remove potential cofactors through chelation or harsh dialysis

  • Monitor activity loss concurrent with cofactor removal

  • Attempt reconstitution with candidate cofactors to restore activity

  • Use site-directed mutagenesis to alter putative cofactor-binding residues

This integrative approach will provide compelling evidence for or against the presence of cofactors or prosthetic groups in AF_1740, contributing to functional annotation of this uncharacterized protein.

How can researchers address the challenge of protein insolubility when working with recombinant AF_1740?

Insolubility is a common challenge when working with recombinant Archaeoglobus fulgidus UPF0290 protein AF_1740 due to its hydrophobic transmembrane regions and the substantial differences between archaeal and heterologous expression environments. A systematic approach to addressing this challenge involves:

Optimizing expression conditions:

  • Modulate induction parameters:

    • Reduce inducer concentration to 0.1-0.2 mM IPTG (for T7-based systems)

    • Lower post-induction temperature to 15-18°C

    • Extend expression time to 16-24 hours at these reduced temperatures

  • Optimize media formulation:

    • Use enriched media such as Terrific Broth with added glucose (0.5-1%)

    • Include osmolytes like betaine (2-10 mM) to enhance protein folding

    • Add specific metal ions that might be required for proper folding

  • Co-express with molecular chaperones:

    • GroEL/GroES, DnaK/DnaJ/GrpE, or trigger factor

    • Archaeal-specific chaperones if available

Fusion protein strategies:

  • N-terminal fusions that enhance solubility:

    • Maltose-binding protein (MBP)

    • NusA or SUMO tags

    • Thioredoxin

  • Include a cleavable linker between the fusion partner and AF_1740

  • Carefully design constructs to avoid disrupting transmembrane domain organization

Extraction and solubilization optimization:

  • Systematic detergent screening:

    Detergent ClassExamplesStarting Concentration
    Mild non-ionicDDM, OG1-2%
    ZwitterionicLDAO, FC-120.5-1%
    Steroid-basedDigitonin, CHAPS0.5-1%
    Newer amphipolsA8-35, PMAL-C8Per manufacturer
  • Optimize solubilization conditions:

    • Vary salt concentration (300-500 mM NaCl)

    • Test pH range (pH 5.5-8.0)

    • Include glycerol (10-20%) as a stabilizing agent

    • Add specific lipids that might be required for proper folding

Alternative approaches for recalcitrant constructs:

  • Cell-free expression systems directly into detergent micelles or nanodiscs

  • Refolding protocols from inclusion bodies:

    • Solubilize in strong denaturants (8M urea or 6M guanidinium HCl)

    • Carefully remove denaturant by dialysis in the presence of appropriate detergents

    • Monitor refolding by circular dichroism or fluorescence spectroscopy

  • Consider membrane scaffold protein (MSP) nanodisc technology to provide a more native-like membrane environment

By systematically applying these approaches, researchers can often overcome insolubility issues with AF_1740 while maintaining protein functionality for downstream analyses.

What are the common pitfalls in interpreting functional data for poorly characterized proteins like AF_1740?

Overinterpretation of sequence homology:

Tag interference with native function:

  • Affinity tags or fluorescent protein fusions may disrupt protein folding or interactions

  • The impact may vary depending on tag placement (N-terminal vs. C-terminal)

  • Mitigation strategy: Include tag-free controls and compare multiple tag positions

  • Verify that tagged protein maintains expected biochemical properties

Non-native lipid environment effects:

  • AF_1740's function may be highly dependent on specific archaeal lipids

  • Standard detergent micelles or non-archaeal membranes may not support native function

  • Mitigation strategy: Test function in various membrane mimetics including archaeal lipid extracts

  • Consider the impact of ether-linked vs. ester-linked lipids on protein behavior

Data interpretation in the absence of known substrates:

  • Functional assays require hypotheses about potential substrates or activities

  • Negative results may reflect inappropriate assay conditions rather than lack of function

  • Mitigation strategy: Cast a wide net with diverse substrate panels and assay conditions

  • Use unbiased approaches like metabolomic profiling to identify potential substrates

Evolutionary context misinterpretation:

Confirmation bias in data analysis:

By recognizing these potential pitfalls and implementing appropriate countermeasures, researchers can develop more robust interpretations of functional data for AF_1740 and other poorly characterized archaeal proteins.

How can coexpression network analysis be applied to understand AF_1740's functional context?

Coexpression network analysis represents a powerful approach for contextualizing Archaeoglobus fulgidus UPF0290 protein AF_1740 within its functional landscape. Drawing from methodologies applied to other biological systems, researchers can implement the following framework:

Generating transcriptomic datasets:

  • Culture A. fulgidus under various conditions that might influence AF_1740 expression:

    • Temperature gradients (65-95°C)

    • Varying electron acceptors (sulfate, thiosulfate, etc.)

    • Nutrient limitations

    • Stress conditions (oxidative, pH, osmotic)

  • Extract RNA and perform RNA-Seq with sufficient biological replicates (minimum 3-5)

  • Process data using established archaeal transcriptome analysis pipelines

Weighted gene coexpression network analysis (WGCNA):
Similar to approaches used for human genes , apply WGCNA to identify functional modules:

  • Calculate pairwise correlations between all gene expression profiles

  • Transform correlations using a power function to emphasize strong correlations

  • Identify modules of highly interconnected genes

  • Determine which module contains AF_1740 and analyze its composition

  • Identify hub genes that might be functionally related to AF_1740

The following table outlines potential outcomes from such analysis:

Network FeatureInterpretationFollow-up Approaches
AF_1740 as hub geneCentral functional importancePrioritize for detailed characterization
Module enriched for membrane proteinsPotential structural/transport complexCo-immunoprecipitation of module members
Module response to specific stressFunctional role in stress responseTargeted stress experiments
Module enriched for metabolic enzymesRole in specific metabolic pathwayMetabolic profiling under relevant conditions

Integration with comparative genomics:

  • Identify organisms with AF_1740 homologs

  • Compare genomic context (neighboring genes)

  • Analyze conservation of coexpression relationships across species

  • Look for conserved gene clusters or operons containing AF_1740 homologs

Experimental validation of network predictions:

  • Select top coexpressed genes for targeted validation

  • Perform protein-protein interaction studies on key candidates

  • Generate gene deletions or CRISPR interference for top network neighbors

  • Test phenotypic consequences under conditions where the module is active

By applying this systematic approach, researchers can generate testable hypotheses about AF_1740's function based on its transcriptional relationships with better-characterized genes. This is particularly valuable for proteins like AF_1740 where experimental characterization may be challenging due to the extremophilic nature of the source organism.

What evolutionary insights can be gained from comparing AF_1740 with homologs in other extremophiles?

Comparative evolutionary analysis of Archaeoglobus fulgidus UPF0290 protein AF_1740 with homologs in other extremophiles can provide valuable insights into adaptation mechanisms and functional conservation across diverse environments. This approach involves systematic comparison at multiple levels:

Sequence-based evolutionary analysis:

  • Identify homologs using sensitive search methods (PSI-BLAST, HMMer, HHpred)

  • Construct comprehensive multiple sequence alignments

  • Generate phylogenetic trees to map evolutionary relationships

  • Calculate selection pressures (dN/dS ratios) to identify conserved functional residues

  • Map conservation patterns onto predicted structural models

Structural comparison across extremophilic adaptations:
Comparing AF_1740 homologs across extremophiles reveals adaptation patterns:

Extremophile TypeExample OrganismsExpected Adaptations in AF_1740 Homologs
HyperthermophilesPyrococcus furiosus, Thermococcus kodakarensisIncreased charged residues, disulfide bonds, decreased loops
HalophilesHalobacterium salinarum, Haloferax volcaniiAcidic residue enrichment on surface, specialized ion coordination
AcidophilesThermoplasma acidophilum, Picrophilus torridusReduced surface charge, stabilized acid-labile bonds
PsychrophilesMethanococcoides burtoniiIncreased flexibility, reduced hydrophobic core packing

Genomic context conservation:

  • Analyze conservation of gene neighborhoods across species

  • Identify syntenic relationships that might indicate functional associations

  • Compare with non-extremophilic organisms containing homologs

  • Look for co-evolution patterns with interacting partners

Integration with experimental data:

  • Compare experimentally determined properties across homologs (when available)

  • Correlate sequence/structural differences with functional divergence

  • Use ancestral sequence reconstruction to infer evolutionary trajectories

  • Test hypotheses through site-directed mutagenesis of conserved residues

Broader evolutionary insights:

  • Position of AF_1740 homologs in the context of the "lipid divide" between Archaea and Bacteria

  • Potential horizontal gene transfer events involving AF_1740 homologs

  • Implications for early evolution of membrane proteins in LUCA (Last Universal Common Ancestor)

  • Correlation between environmental adaptation and UPF0290 family diversification

This evolutionary perspective provides a powerful framework for understanding AF_1740's function and adaptation mechanisms. By identifying conserved features across diverse extremophiles, researchers can prioritize specific residues and regions for functional studies, potentially uncovering novel adaptation mechanisms that contribute to protein stability and function in extreme environments.

What novel experimental approaches might accelerate functional characterization of AF_1740?

Accelerating the functional characterization of Archaeoglobus fulgidus UPF0290 protein AF_1740 requires innovative approaches that address the unique challenges of studying archaeal proteins. The following cutting-edge methodologies offer promising avenues for future research:

Cryo-electron microscopy for membrane protein structure:

  • Recent advances in single-particle cryo-EM have revolutionized membrane protein structural biology

  • Sample preparation using nanodiscs or amphipols may preserve native-like environments

  • Direct visualization of AF_1740 structure would provide immediate insights into potential functions

  • Visualization of bound cofactors or substrates could be achieved through systematic ligand screening

AlphaFold2 and structure prediction integration:

  • Generate AF_1740 structural models using AlphaFold2 or RoseTTAFold

  • Validate predictions through limited experimental data (crosslinking, EPR, SAXS)

  • Use predicted structures to guide rational mutagenesis and functional hypothesis generation

  • Apply molecular dynamics simulations to explore conformational dynamics in archaeal membranes

CRISPR-based archaeal genetics:

  • Recently developed CRISPR systems for archaeal organisms enable precise genetic manipulation

  • Generate AF_1740 knockout or knockdown strains in model archaeal systems

  • Perform complementation studies with mutant variants to identify critical residues

  • Deploy CRISPRi for temporal control of AF_1740 expression to study immediate effects

High-throughput substrate screening:

  • Develop reconstituted systems for transport or enzymatic activity assays

  • Screen diverse metabolite libraries using technologies like mass spectrometry

  • Deploy thermal shift assays to identify stabilizing ligands

  • Apply differential scanning fluorimetry across condition gradients

Synthetic biology approaches:

  • Express AF_1740 in simplified "minimal cells" lacking endogenous homologs

  • Design synthetic circuits to couple AF_1740 function to reporter outputs

  • Engineer chimeric proteins with homologs of known function to narrow functional space

  • Create conditional auxotrophs dependent on AF_1740 function for genetic selection

Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data from AF_1740 mutants

  • Apply machine learning to identify patterns associated with AF_1740 perturbation

  • Use coexpression network analysis to position AF_1740 in functional modules

  • Correlate phenotypic changes with molecular alterations to infer function

Parallel evolutionary analysis:

  • Identify instances of convergent evolution in AF_1740 homologs

  • Map sequence changes to environmental adaptations

  • Apply evolutionary coupling analysis to predict interacting residues

  • Reconstruct ancestral sequences to understand evolutionary trajectories

By integrating these novel approaches, researchers can overcome the challenges associated with studying archaeal proteins and accelerate functional characterization of AF_1740, potentially revealing new principles of protein structure and function in extremophiles.

How could understanding AF_1740 contribute to biotechnological applications?

Understanding the structure and function of Archaeoglobus fulgidus UPF0290 protein AF_1740 has significant potential to advance several biotechnological applications that leverage the unique properties of archaeal proteins. These applications span multiple industries and technological domains:

Thermostable enzymes for industrial processes:

  • If AF_1740 demonstrates enzymatic activity, its thermostable nature would be valuable for high-temperature industrial processes

  • Potential applications in biofuel production, food processing, or chemical synthesis

  • The protein's stability could be engineered into mesophilic enzymes to enhance their industrial utility

  • Methodological approaches similar to those used for other archaeal enzymes could be applied for optimization

Membrane protein engineering platforms:

  • Understanding the structural basis for AF_1740's stability could inform design principles for membrane protein engineering

  • Development of stable membrane protein scaffolds for biosensor applications

  • Creation of robust membrane protein expression systems for difficult targets

  • Engineering of thermostable ion channels or transporters for synthetic biology applications

Novel biomaterials development:

  • Archaeal membrane proteins like AF_1740 could inspire biomimetic materials for extreme environments

  • Potential applications in high-temperature filtration, separation technologies, or sensing devices

  • Development of protein-based materials with enhanced stability for medical or industrial applications

  • Integration with archaeal lipid technology to create novel membrane mimetics

Drug discovery applications:

  • AF_1740's potential role in archaeal membrane function could reveal novel antimicrobial targets

  • Development of screening platforms for compounds targeting related proteins in pathogenic archaea

  • Structural insights could inform drug design targeting homologous proteins in human pathogens

  • Use as a stable scaffold for displaying peptides or small molecules in drug discovery applications

Synthetic biology tools:

  • Deployment as components in synthetic circuits designed to function under extreme conditions

  • Development of archaeal expression systems for biotechnology applications

  • Creation of minimal cell platforms incorporating archaeal membrane components

  • Engineering of robust biosensors for environmental monitoring in extreme conditions

Bionanotechnology applications:

  • Integration of AF_1740 into nanostructured materials for enhanced stability

  • Development of protein-based nanoparticles for targeted delivery systems

  • Creation of hybrid materials combining archaeal proteins with synthetic nanostructures

  • Engineering of self-assembling systems based on AF_1740's interaction properties

The unique evolutionary history and extremophilic adaptations of AF_1740 make it a valuable subject for biotechnological exploration, potentially revealing novel principles that can be applied across multiple technological domains. By understanding its structure-function relationships, researchers can harness these properties for applications that require exceptional stability and performance under challenging conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.