Recombinant Archaerhodopsin-3 (aop3)

Shipped with Ice Packs
In Stock

Description

Proton Pumping Activity

  • Mechanism: Light absorption triggers outward proton transport via a photocycle involving intermediates (K, M, N, O) .

  • Performance: Maintains proton flux even with non-natural chromophores (e.g., AO3-DMP), albeit with slower photocycling rates .

Voltage-Sensitive Fluorescence

  • Emission: Weak near-infrared fluorescence (λem ≈ 670 nm) with voltage sensitivity .

  • Detection: Fluorescence intensity changes can be monitored under low-intensity LED (0.15 W/cm²), enabling real-time voltage imaging in neurons .

VariantFluorescence Intensity (Normalized)Quantum Yield
Wild-Type AR31.0 (baseline)0.001 (all-trans isomer)
Archon1 (Mutant)2.5× higher than AR3Not reported
DETC/Arch-5 MutantsReduced isomerization yield (20× lower)0.00005

Optogenetic Applications

Recombinant AR3 is widely utilized for:

  1. Neural Silencing: Induces hyperpolarization via outward proton pumping, suppressing action potentials .

  2. Voltage Imaging: Fluorescent variants (e.g., Archon1) enable non-invasive monitoring of membrane potential changes in real time .

  3. Lysosomal Acidification: Targets intracellular organelles to modulate pH in subcellular compartments .

Engineering and Mutagenesis

Recent advancements focus on enhancing fluorescence efficiency and spectral tuning:

  • TIDIR Mechanism: Wild-type AR3 exhibits a twisted diradical (TIDIR) intermediate during retinal isomerization, enabling ultrafast (300 fs) photodynamics .

  • Mutant Design: Arch-5 and DETC variants show mixed retinal isomers (all-trans/15-anti and 13-cis/15-syn), reducing quantum yield but stabilizing fluorescence .

Challenges and Future Directions

  • Photostability: Prolonged illumination causes photobleaching, limiting long-term imaging .

  • Spectral Optimization: Engineering red-shifted variants could improve tissue penetration for in vivo applications .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
aop3; Archaerhodopsin-3; AR 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
7-258
Protein Length
Full Length of Mature Protein
Species
Halorubrum sodomense
Target Names
aop3
Target Protein Sequence
QAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAREYYAVTILVPGIASAA YLSMFFGIGLTEVTVGGEMLDIYYARYADWLFTTPLLLLDLALLAKVDRVTIGTLVGVDA LMIVTGLIGALSHTAIARYSWWLFSTICMIVVLYFLATSLRSAAKERGPEVASTFNTLTA LVLVLWTAYPILWIIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTEAP EPSAGADVSAAD
Uniprot No.

Target Background

Function
Light-driven proton pump.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaerhodopsin-3 and what is its basic structure?

Archaerhodopsin-3 (AR3) is a microbial rhodopsin protein originally isolated from the archaebacterium Halobacterium sodomense. Structurally, AR3 consists of seven transmembrane (TM) helices and a single, extracellular-facing, two-stranded β-sheet, consistent with circular dichroism data . The protein contains a retinal chromophore (vitamin-A aldehyde) covalently bound via a Schiff Base (SB) linkage to residue Lys226, creating the retinylidene chromophore that enables light sensitivity . This architecture is similar to other archaeal rhodopsins, sharing approximately 59% sequence identity with bacteriorhodopsin (bR) . Functionally, AR3 serves as an outward proton pump with activity comparable to bacteriorhodopsin when expressed in Xenopus oocytes .

How does AR3 respond to light stimulation?

When the ground state of AR3 is stimulated by light of appropriate wavelength, the protein undergoes a highly ordered sequence of conformational changes known collectively as the photocycle . This process begins with a light-induced change in the isomerization state of the retinal chromophore. Wild-type AR3 has an absorption maximum at 556 nm in its natural form . During the photocycle, several intermediates form, including the N-intermediate and Q-intermediate, with the latter being responsible for fluorescence emission . Spectroscopic studies reveal that AR3 exhibits voltage-dependent fluorescence changes, allowing it to function as a genetically encoded voltage indicator in mammalian cells .

What are the differences between dark-adapted and light-adapted states of AR3?

AR3 exists in two distinct states: the dark-adapted (DA) state, which forms in the prolonged absence of light, and the light-adapted (LA) ground state. High-resolution crystal structures have revealed significant differences between these states:

  • In the DA state, there is a thermodynamic equilibrium between different retinal isomers, allowing both cis and trans conformations .

  • The LA state predominantly contains the all-trans retinal configuration .

  • The two states show different arrangements of internal water molecules that are coupled via hydrogen bonds to the retinal Schiff Base .

  • QM/MM calculations demonstrate that these water network differences affect the energy barriers for retinal isomerization .

These structural differences explain how the DA state permits a thermodynamic equilibrium between retinal isomers while the LA state prevents such changes in the absence of light stimulation .

How can AR3 be expressed and purified for experimental studies?

For high-resolution structural studies, wild-type AR3 has been purified directly from H. sodomense cells without genetic modification . The purification process notably avoids detergents, which can disrupt protein function . Protein crystals for structural determination can be grown in lipidic cubic phase (LCP), which provides a membrane-like environment that helps maintain the protein's native conformation .

For functional studies in mammalian systems, AR3 is typically expressed as a fusion protein with fluorescent reporters like EGFP to monitor expression levels and subcellular localization. Transfection of mammalian cell lines (such as HEK293) allows for the expression of functional AR3 that localizes primarily to the plasma membrane .

What techniques are used to characterize the spectral properties of AR3?

Several complementary methods are employed to characterize AR3's spectral properties:

  • Absorption spectroscopy: Used to determine the absorption maximum of AR3 variants. Wild-type AR3 shows a peak at 556 nm, while variants with modified retinal (such as AO3-DMP) exhibit shifted absorbance (508 nm) .

  • Time-resolved spectroscopy: Measures the kinetics of the photocycle and transition rates between intermediates .

  • QM/MM (Quantum Mechanics/Molecular Mechanics) calculations: These computational approaches help explain spectral shifts by analyzing the HOMO-LUMO energy gap of the chromophore and the electrostatic interactions between the retinal Schiff base and surrounding residues .

  • Fluorescence detection using variable light intensities: Traditional intense laser stimulation (1-1000 W/cm²) has been used, but recent work demonstrates that low-intensity LED stimulation (0.15 W/cm²) with longer exposure times (500 ms) can also detect AR3 fluorescence without causing phototoxicity .

How can AR3-mediated fluorescence be detected in live cells?

Detecting AR3's relatively weak fluorescence in live cells requires specific methodological approaches:

  • Normalization strategy: AR3 is often expressed as a fusion protein with EGFP, allowing normalization of near-infrared (NIR) fluorescence intensity against EGFP fluorescence as an index of protein expression .

  • Illumination techniques:

    • High-intensity laser illumination (1-1000 W/cm²) provides high spatiotemporal resolution but risks photodamage during long-term imaging .

    • Alternative low-intensity LED stimulation (0.15 W/cm²) with longer exposure times (500 ms) enables real-time imaging of drug-induced slow voltage changes over minutes without fluorescence bleaching or cell damage .

  • Signal processing: The normalized NIR fluorescence intensity from AR3-EGFP expressing cells must be corrected by subtracting the normalized NIR fluorescence of EGFP-only expressing cells to determine the actual rhodopsin fluorescence contribution .

Table 1: Comparison of AR3 fluorescence detection methods

ParameterHigh-intensity laserLow-intensity LED
Light intensity1-1000 W/cm²0.15 W/cm²
Exposure timeShort (ms)Long (500 ms)
Temporal resolutionHighModerate
SuitabilityFast events (action potentials)Slow voltage changes
Phototoxicity riskHighLow
Imaging durationSecondsMinutes to hours

How is AR3 utilized as a genetically encoded voltage indicator?

AR3 and its variants function as genetically encoded voltage indicators (GEVIs) through their voltage-dependent fluorescence properties. The advantages of AR3-based GEVIs include :

  • Genetic targeting: Unlike electrode-based methods or voltage-sensitive dyes, AR3-based indicators can be precisely targeted to specific cell types using genetic approaches.

  • Non-invasive imaging: AR3 allows for non-invasive visualization of membrane voltage changes in individual cells.

  • Direct visualization: AR3 enables direct observation of membrane voltage dynamics on millisecond timescales.

The voltage sensitivity of AR3 fluorescence makes it particularly valuable for monitoring neuronal activity, although the mechanism of this voltage dependence is still being investigated. Implementation typically involves expressing AR3 or its variants (like Archon1) in target cells, followed by fluorescence imaging using appropriate illumination and detection systems .

What variants of AR3 have been developed for improved optogenetic applications?

Several engineered variants of AR3 have been developed to enhance its properties for optogenetic applications:

  • QuasAr1 and QuasAr2: Enhanced fluorescence yield and improved signal-to-noise ratio .

  • Archon1 and Archon2: Archon1 shows significantly higher fluorescence intensity compared to wild-type AR3 as demonstrated in HEK293 cells .

  • paQuasAr3: Improved membrane localization and response kinetics .

  • NovArch and QuasAr6: Further optimized variants with enhanced properties .

These variants have been progressively produced through random mutagenesis approaches targeting improvements in fluorescence yield, signal-to-noise ratio, membrane localization, and response kinetics . Experimental data shows that Archon1's rhodopsin fluorescence intensity is significantly higher than that of wild-type AR3 when measured under identical conditions .

What are the mechanisms of AR3 fluorescence and how do they differ between variants?

The fluorescence mechanisms differ between wild-type AR3 and its engineered variants:

  • Wild-type AR3: Fluorescence is emitted from the Q-intermediate in the photocycle. Since this intermediate is formed after photon absorption by the N-intermediate, a three-photon excitation process (first photon to initial state, second to N-intermediate, third to Q-intermediate) is required for fluorescence emission .

  • Engineered variants (QuasAr2, Archon1): Fluorescence is proposed to be emitted directly from the excited state rather than requiring the formation of specific intermediates . This fundamental difference in mechanism explains the improved fluorescence properties of these variants.

DETC and Arch-5 variants display a mixture of all-trans/15-anti and 13-cis/15-syn isomers, leading to a bi-exponential excited state decay. Their isomerization quantum yield is reduced more than 20 times compared to wild-type AR3, confirming that steady-state fluorescence is induced by a single absorption photon event rather than requiring multiple photons .

What is the twisted diradical (TIDIR) state in AR3 and why is it significant?

In wild-type AR3, research has identified an unusual photochemical process where a 300 femtosecond, barrier-less and vibrationally coherent isomerization is driven by an unusual covalent electronic character of the all-trans retinal chromophore . This process leads to a metastable twisted diradical (TIDIR) state .

The TIDIR mechanism represents a significant departure from the standard charge-transfer scenario established for other microbial rhodopsins . This unique photochemical characteristic makes AR3 an ideal candidate for the design of variants with one-photon induced fluorescence that could potentially reach emission quantum yields comparable to natural emitters like neorhodopsin (NeoR) .

The discovery of this mechanism provides critical insights for rational engineering of AR3 variants with enhanced fluorescence properties, potentially eliminating the need for the three-photon excitation process required in wild-type AR3 .

How do modifications to the retinal binding pocket affect AR3 function?

Modifications to AR3's retinal binding pocket can significantly alter its spectral and functional properties. Research using synthetic retinal analogs demonstrates this principle:

A study with dimethyl phenylated retinal derivative (DMP-retinal) incorporated into AR3's opsin (archaeopsin-3, AO3) revealed several significant changes :

  • Spectral shift: The absorption maximum shifted from 556 nm (with natural A1-retinal) to 508 nm (with DMP-retinal) .

  • Photocycle kinetics: Time-resolved spectroscopic measurements showed significantly decreased photocycling rates .

  • Chromophore stability: The sensitivity of the chromophore binding Schiff base to attack by hydroxylamine increased significantly .

  • Structural changes: QM/MM calculations revealed that the DMP-retinal created a cavity space at the aromatic ring moiety that is absent in the natural configuration .

  • Functional impact: Despite these changes, AO3-DMP maintained outward proton pumping activity, albeit at a slower rate .

These findings demonstrate how the retinal binding cavity can accommodate modified chromophores and how such modifications systematically alter the protein's spectroscopic and functional properties .

What computational approaches are used to understand AR3's molecular mechanisms?

Advanced computational techniques play a crucial role in understanding AR3's molecular mechanisms:

  • QM/MM (Quantum Mechanics/Molecular Mechanics) calculations: This hybrid approach treats the chromophore and key interacting residues with quantum mechanical methods while modeling the rest of the protein with molecular mechanics . QM/MM has been used to:

    • Explain spectral shifts observed with modified retinal analogs by analyzing changes in HOMO-LUMO energy gaps

    • Understand how internal water networks influence retinal isomerization energy barriers

    • Identify the unusual electronic character of retinal in AR3 that leads to the TIDIR state

  • Molecular dynamics simulations: Used to model protein dynamics and conformational changes during the photocycle .

  • Computational docking: Applied to predict whether synthetic retinal analogs can be incorporated into the opsin binding pocket .

These computational approaches provide crucial insights that complement experimental data, helping researchers understand the mechanistic details of AR3 function at atomic and electronic levels.

How does the photocycle kinetics of AR3 compare to other microbial rhodopsins?

AR3's photocycle shows distinctive features compared to other microbial rhodopsins:

  • The ground state absorption of AR3 (556 nm) differs from bacteriorhodopsin (568 nm) despite their 59% sequence identity, indicating subtle differences in chromophore environment .

  • The arrangement of internal water networks in AR3 results in faster photocycle kinetics compared to homologs like bacteriorhodopsin .

  • Unlike many other microbial rhodopsins that operate primarily through a charge-transfer mechanism, AR3 exhibits an unusual covalent electronic character in its excited state that leads to the formation of the twisted diradical (TIDIR) intermediate .

  • The transitions between photocycle intermediates in AR3 have distinctive kinetics, with the 300 fs barrier-less isomerization being particularly noteworthy for its speed and efficiency .

Understanding these comparative aspects is crucial for rational engineering of AR3 variants with optimized properties for specific optogenetic applications.

What are the key challenges in using AR3 for long-term voltage imaging?

Several technical challenges must be addressed when using AR3 for long-term voltage imaging:

  • Low fluorescence yield: AR3 exhibits significantly lower fluorescence intensity (1/10-1/500) compared to enhanced green fluorescent protein (EGFP) . This necessitates either high-intensity illumination or longer exposure times.

  • Phototoxicity risk: Traditional high-intensity laser stimulation (1-1000 W/cm²) can cause cellular damage during prolonged imaging sessions . Researchers must balance signal quality with cellular health.

  • Multi-photon requirements: In wild-type AR3, fluorescence emission requires a three-photon excitation process, further complicating imaging protocols .

  • Protein expression and trafficking: Ensuring consistent membrane localization of AR3 across different cell types requires optimization of expression systems and potentially fusion with trafficking-enhancing domains .

Recent methodological advances using low-intensity LED illumination (0.15 W/cm²) with longer exposure times (500 ms) show promise for enabling extended imaging sessions with minimal phototoxicity, allowing researchers to monitor slow voltage changes over minutes without damaging cells or causing fluorescence bleaching .

How can researchers optimize AR3 expression systems for different experimental applications?

Optimizing AR3 expression requires consideration of several factors:

  • Expression vector design: For mammalian expression, codon-optimized constructs with strong promoters (like CMV) are typically used . Including a fluorescent protein tag (such as EGFP) enables monitoring of expression levels and proper localization .

  • Membrane trafficking: Adding trafficking signals or membrane localization sequences can improve surface expression. Some AR3 variants (like Archon1) have been engineered for better membrane localization .

  • Cell-type specific considerations:

    • For neurons, neuron-specific promoters can restrict expression to target populations

    • For stable cell lines, selection markers and inducible expression systems may be preferred

    • For in vivo applications, viral delivery systems with appropriate tropism must be selected

  • Chromophore availability: Ensuring sufficient retinal is available for proper folding and function by either supplementing with exogenous retinal or confirming adequate endogenous production in the experimental system .

  • Expression level control: Titrating expression levels to achieve sufficient signal while avoiding potential artifacts from overexpression through promoter strength adjustment or inducible systems.

Each application may require specific optimization strategies to balance protein expression, localization, and functional properties for successful implementation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.