Recombinant Arcobacter butzleri NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arcobacter butzleri NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Arcobacter butzleri NADH-quinone oxidoreductase subunit K (nuoK) is a bioengineered protein derived from the nuoK gene (Abu_0305) of Arcobacter butzleri, a diarrheagenic pathogen linked to poultry and water reservoirs . This subunit is part of NADH dehydrogenase I (Complex I), a proton-pumping enzyme in bacterial respiratory chains that transfers electrons from NADH to quinones while translocating protons across the membrane . The recombinant version is typically expressed in E. coli and purified for research or diagnostic applications .

Recombinant Expression

  • Host: E. coli .

  • Expression Vector: Not explicitly detailed in sources, but inferred to include inducible promoters (e.g., T7) for regulated expression.

  • Purification: Affinity chromatography (via His-tag) followed by lyophilization .

Quality Control

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

Diagnostic and Functional Studies

  • ELISA Development: Recombinant nuoK is used as an antigen in immunoassays to detect A. butzleri infections .

  • Antibiotic Resistance Context: While nuoK itself is not directly linked to antibiotic resistance, A. butzleri genomes harboring multidrug-resistant (MDR) phenotypes (e.g., oxa-464) may utilize alternative electron donors (e.g., flavodoxin) in Complex I under stress .

Genomic and Pathogenicity Context

Comparative Analysis of Recombinant Variants

Source/VariantProtein LengthPurityTagUniprot ID
Creative Biomat (RFL33500AF)Full-length (1–103)>90%His-taggedA8ERK6
Cusabio (CSB-EP371838EJE1-B)Partial>85%Not specifiedA1ADC7
MyBioSource (MBS7024163)PartialNot specifiedNot specifiedB3Q6S6

Notes:

  • Full-Length vs. Partial: Full-length versions (e.g., ) are preferred for structural studies, while partial variants may target specific epitopes .

  • Taxonomic Variability: Different UniProt IDs (e.g., A1ADC7 vs. A8ERK6) reflect strain-specific variations in A. butzleri or related species .

Challenges and Future Directions

  • Mechanistic Gaps: Limited data on nuoK’s precise role in proton translocation or interaction with other Complex I subunits .

  • Therapeutic Targets: While Complex I is essential for bacterial respiration, targeting nuoK directly is not yet explored in antimicrobial strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
nuoK; Abu_0305; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Arcobacter butzleri (strain RM4018)
Target Names
nuoK
Target Protein Sequence
MVSLTSYAFVSMMLFSIGAIGVIARKNIFVIYMSIEMMLNGINLFLITFARYHFNIDPQI ITVMVISIAAAEAAIFLSVIILLFRSKKSLNTDVFTSLTQGEN
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Arcobacter butzleri NADH-quinone oxidoreductase subunit K (nuoK) and what is its function?

Arcobacter butzleri NADH-quinone oxidoreductase subunit K (nuoK) is a component of the respiratory chain complex I in this bacterial species. It functions as part of the NADH dehydrogenase I system, which is crucial for energy metabolism and electron transport. This membrane-embedded subunit plays a key role in the process of oxidative phosphorylation, where electrons from NADH are transferred to quinones, contributing to the proton gradient necessary for ATP synthesis .

The nuoK protein in A. butzleri is one of several subunits that make up the NADH:quinone oxidoreductase complex, which represents the initial step of the aerobic/microaerobic respiratory pathway in this organism. The functional complex facilitates the coupling of NADH oxidation to proton translocation across the bacterial membrane .

How does A. butzleri nuoK compare to homologous proteins in other bacterial species?

A. butzleri nuoK shares functional similarities with homologous proteins in other bacteria, particularly within the epsilon subdivision of Proteobacteria. Phylogenetic analysis of respiratory proteins suggests that A. butzleri's respiratory apparatus, including the NADH:quinone oxidoreductase complex containing nuoK, has an evolutionary history distinct from those of related genera such as Campylobacter and Helicobacter .

The genome analysis of A. butzleri strain RM4018 indicates that many of its respiratory proteins, including components of complex I, show higher similarity to those found in Sulfuromonas denitrificans and Wolinella succinogenes (members of the Helicobacteraceae) than to its taxonomic relatives in the Campylobacteraceae family . This suggests a complex evolutionary history that may involve horizontal gene transfer events.

What experimental approaches are most effective for studying the function of recombinant A. butzleri nuoK in vitro?

For functional studies of recombinant A. butzleri nuoK, a multi-faceted experimental approach is recommended:

  • Membrane reconstitution assays: Since nuoK is a membrane protein, reconstitution into proteoliposomes or nanodiscs can help maintain its native conformation for functional studies. This approach allows for measurement of proton translocation and electron transport activities.

  • Site-directed mutagenesis: Introducing specific mutations in conserved residues of nuoK can provide insights into structure-function relationships. Particular attention should be paid to the transmembrane regions and residues predicted to interact with other subunits of the complex.

  • Electron transport chain activity measurements: The function of reconstituted complex I containing recombinant nuoK can be assessed by monitoring NADH oxidation rates spectrophotometrically, typically by following the decrease in absorbance at 340 nm.

  • Protein-protein interaction studies: Techniques such as cross-linking followed by mass spectrometry or blue native PAGE can identify interactions between nuoK and other subunits of the NADH:quinone oxidoreductase complex .

These approaches should be complemented with biophysical methods to assess protein stability and conformation in different environments, especially considering the challenges associated with membrane protein research.

How does the respiratory chain function of A. butzleri nuoK relate to the organism's pathogenicity?

The relationship between nuoK function and A. butzleri pathogenicity is complex and multifaceted:

  • Energy metabolism during infection: A. butzleri requires efficient energy production during infection, and the NADH:quinone oxidoreductase complex containing nuoK is central to this process. The functionality of this complex directly impacts the organism's ability to grow and persist in host environments.

  • Adaptation to microaerobic conditions: A. butzleri is known to contain a full complement of genes for aerobic/microaerobic respiration, including those encoding NADH:quinone oxidoreductase . This respiratory flexibility, facilitated by proteins including nuoK, likely contributes to the pathogen's ability to colonize different host niches with varying oxygen concentrations.

  • Relationship to clinical presentation: A. butzleri infections are associated with persistent, watery diarrhea more frequently than bloody diarrhea (when compared to Campylobacter jejuni) . This distinct clinical presentation may be partially related to the organism's metabolic capabilities and energy generation systems, including the respiratory chain complexes.

Research data indicates that A. butzleri ranks as the fourth most common Campylobacter-like organism isolated from clinical specimens . Its pathogenic potential appears similar to other species in the genus, suggesting that its core metabolic functions, including those mediated by respiratory proteins like nuoK, are important determinants of virulence.

What challenges exist in expressing and purifying functional recombinant A. butzleri nuoK for structural studies?

Several significant challenges complicate the expression and purification of functional recombinant A. butzleri nuoK:

  • Membrane protein expression barriers: As a hydrophobic membrane protein, nuoK is difficult to express in conventional expression systems. The protein may form inclusion bodies or exhibit toxicity to host cells.

  • Maintaining native conformation: Extraction from membranes requires careful selection of detergents that maintain protein structure while efficiently solubilizing the target. The choice between harsh (e.g., SDS) and milder (e.g., DDM, LMNG) detergents presents a critical balance between extraction efficiency and structural integrity.

  • Protein stability challenges: Once extracted, membrane proteins like nuoK often show limited stability in solution. Addition of stabilizing agents such as glycerol (as recommended in the protein handling instructions) becomes crucial for maintaining functionality during purification and storage .

  • Expression system selection: While E. coli is commonly used for recombinant protein production (as seen with the commercially available recombinant nuoK ), alternative expression systems such as Pichia pastoris or cell-free systems may offer advantages for membrane proteins.

  • Functional assessment complexities: As a subunit of a larger complex, isolated nuoK may not display measurable enzymatic activity on its own, making functional validation challenging. Co-expression with interacting partners may be necessary for functional studies.

Researchers should consider these challenges when designing expression constructs, selecting purification strategies, and planning structural studies of this challenging membrane protein.

What are the recommended protocols for handling recombinant A. butzleri nuoK protein?

Based on available information, the following protocols are recommended for handling recombinant A. butzleri nuoK protein:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots may be stored at 4°C for up to one week

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

    • Aliquot for long-term storage at -20°C/-80°C

  • Buffer considerations:

    • The protein is typically supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • This buffer composition helps maintain protein stability during storage and handling

  • Quality control:

    • Purity should be greater than 90% as determined by SDS-PAGE

    • Verification of intact protein can be performed via western blotting with anti-His antibodies

These handling recommendations are critical for maintaining protein integrity and functionality for downstream applications.

How can researchers effectively incorporate A. butzleri nuoK into functional studies of bacterial respiratory systems?

To effectively incorporate A. butzleri nuoK into functional studies of bacterial respiratory systems, researchers should consider the following methodological approaches:

How can structural studies of A. butzleri nuoK contribute to understanding bacterial respiratory chain evolution?

Structural studies of A. butzleri nuoK can provide valuable insights into bacterial respiratory chain evolution through several approaches:

  • Comparative structural analysis: Determining the structure of A. butzleri nuoK and comparing it with homologous proteins from diverse bacterial lineages can reveal evolutionary relationships and functional conservation patterns. This is particularly valuable given that A. butzleri's respiratory proteins show unexpected similarity to those of Sulfuromonas denitrificans and Wolinella succinogenes, despite different taxonomic classifications .

  • Structure-function correlations: Mapping the structural features of nuoK to its functional properties can help identify critical regions that have been conserved or diverged through evolution. This can provide insights into how respiratory complexes have adapted to different ecological niches.

  • Evolutionary trajectory reconstruction: Detailed structural information, combined with sequence data, can help reconstruct the evolutionary history of respiratory complexes across the epsilon subdivision of Proteobacteria, potentially revealing instances of horizontal gene transfer or convergent evolution.

  • Adaptive features identification: Structural studies may reveal unique features of A. butzleri nuoK that contribute to the organism's ability to thrive in diverse environmental conditions, from water systems to human hosts, providing insights into respiratory chain adaptations.

These structural investigations would contribute significantly to understanding how respiratory complexes have evolved in response to different environmental pressures and metabolic requirements.

What is the potential role of A. butzleri nuoK as a target for antimicrobial development?

The potential of A. butzleri nuoK as an antimicrobial target stems from several considerations:

  • Essential metabolic function: As a component of the respiratory chain, nuoK plays a critical role in energy metabolism. Disruption of this function could impair bacterial growth and survival, making it a potentially valuable target.

  • Clinical relevance: A. butzleri has emerged as a significant enteropathogen, ranking as the fourth most common Campylobacter-like organism isolated from clinical specimens . The development of specific antimicrobials targeting this pathogen could address an important clinical need.

  • Structural uniqueness: If structural studies reveal unique features of A. butzleri nuoK compared to homologous proteins in other bacteria or in human mitochondrial respiratory complexes, these differences could be exploited for selective inhibition.

  • Cross-species applicability: Given the similarities in respiratory components across the epsilon subdivision of Proteobacteria, inhibitors developed against A. butzleri nuoK might have broader application against related pathogens like Campylobacter and Helicobacter species.

Future research should focus on:

  • Detailed structural characterization of nuoK to identify potential binding sites for inhibitors

  • High-throughput screening to identify compounds that specifically inhibit nuoK function

  • Evaluation of identified inhibitors for antimicrobial efficacy and specificity

  • Assessment of potential resistance mechanisms that might emerge against nuoK-targeted antimicrobials

How does the study of A. butzleri nuoK inform our understanding of the organism's adaptation to diverse environments?

The study of A. butzleri nuoK provides valuable insights into the organism's environmental adaptability:

  • Respiratory flexibility: A. butzleri possesses a full complement of genes for both aerobic/microaerobic respiration and limited anaerobic respiration . The nuoK protein, as part of the NADH:quinone oxidoreductase complex, contributes to this respiratory flexibility, enabling the organism to adapt to environments with varying oxygen availability.

  • Metabolic adaptation: Genome analysis indicates that "a substantial proportion of the A. butzleri genome is devoted to growth and survival under diverse environmental conditions, with a large number of respiration-associated proteins" . The nuoK protein is part of this adaptive machinery.

  • Comparative genomics insights: The phylogenetic distinctiveness of A. butzleri's respiratory proteins, including those in the NADH:quinone oxidoreductase complex, suggests that these components may have evolved or been acquired specifically to facilitate adaptation to the organism's ecological niches.

  • Clinical correlations: The persistent nature of A. butzleri infections, characterized by watery diarrhea , may reflect the organism's metabolic capabilities and energy generation systems, which allow it to establish and maintain infections in the human gastrointestinal tract.

Research on nuoK and other respiratory components provides a window into the molecular mechanisms underlying A. butzleri's remarkable ability to thrive in environments ranging from water systems to animal hosts to the human gastrointestinal tract.

Technical Specifications of Recombinant A. butzleri nuoK Protein

ParameterSpecification
SpeciesArcobacter butzleri (strain RM4018)
SourceE. coli
TagHis
Protein LengthFull Length (1-103)
FormLyophilized powder
PurityGreater than 90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Temperature-20°C/-80°C
Working Storage4°C for up to one week
Recommended Reconstitution0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol

Data compiled from product information for recombinant A. butzleri nuoK protein .

Comparative Analysis of A. butzleri Respiratory Capabilities

Respiratory ComponentPresence in A. butzleriRelated FunctionGene/Protein Identified
NADH:quinone oxidoreductaseYesElectron transport from NADH to quinonesnuoK and other nuo subunits
Ubiquinol cytochrome c oxidaseYesElectron transport from ubiquinol to cytochrome cPresent in strain RM4018
Cytochrome bd oxidaseYesTerminal oxidase under microaerobic conditionsPresent in strain RM4018
Cytochrome c oxidase (cbb3-type)YesHigh-affinity oxygen reductionPresent in strain RM4018
F1/F0 ATPaseYesATP synthesisPresent in strain RM4018
Hydrogen utilizationYesHydrogen as electron donorhupSL (uptake hydrogenase)
Formate dehydrogenaseYesFormate as electron donorTwo variants (selenocysteine and cysteine homologs)
Malate utilizationYesMalate as electron donorMalate:quinone oxidoreductase (Mqo)

Information compiled from genome analysis data of A. butzleri strain RM4018 .

Future Research Directions and Priorities

Future research on A. butzleri nuoK should prioritize:

  • Detailed structural characterization: Determining the three-dimensional structure of nuoK, both in isolation and as part of the respiratory complex I, would provide valuable insights into its function and evolution.

  • Functional studies in vivo: Developing genetic systems to modify or delete nuoK in A. butzleri would allow for assessment of its importance in bacterial growth, survival, and pathogenicity.

  • Host-pathogen interaction studies: Investigating how respiratory functions mediated by nuoK contribute to A. butzleri's ability to colonize and cause disease in human hosts could reveal new aspects of its pathogenic mechanisms.

  • Comparative studies across strains: Analyzing nuoK sequence conservation and function across different A. butzleri strains could help identify strain-specific adaptations and correlate them with ecological or clinical characteristics.

  • Drug discovery initiatives: Exploring nuoK as a potential target for novel antimicrobials could address the need for specific therapeutics against this emerging pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.