Recombinant Arcobacter butzleri Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Abu_1267; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Arcobacter butzleri (strain RM4018)
Target Names
lgt
Target Protein Sequence
MEFWQNIYSHFNPVAFNLGSIAVHWYGIMYALALLSAIFVAKWFIKHDKLAISNDLFDSY IWWAEIGVILGARLGYVLFYDSHTMYYITHPWQIFNPYINGVYAGISGMSYHGAFFGFII ASYLFCRKNKVSFWFITDIAVLGVSAAYIFGRLGNFFNQELIGRVTDVPWGIYVGGVLRH PSQIYEAILEGLFVFLILAFYRKRKTFDGQLALMYGILYAIARIIAEFFRQPDSQLGFLV GEWLTMGILQSLIILIICVGFYVVRRKIIIKN
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Lgt in bacterial systems and specifically in A. butzleri?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first critical step in the biogenesis of bacterial lipoproteins, which are essential components for bacterial growth and pathogenesis. In Gram-negative bacteria including A. butzleri, Lgt attaches a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved +1 position cysteine within the lipobox sequence ([LVI][ASTVI][GAS]C) via a thioether bond . This step occurs after preprolipoproteins are secreted through the inner membrane via Sec or Tat pathways. The diacylglyceryl modification is essential for subsequent processing by LspA and Lnt enzymes in the lipoprotein maturation pathway.

Research methodologies to investigate this function typically include:

  • Inducible deletion systems to study phenotypic effects of Lgt depletion

  • Biochemical assays measuring glycerol phosphate release during catalytic activity

  • Western blot analysis to detect accumulation of unprocessed prolipoproteins

  • Membrane permeability assays to assess envelope integrity

How does A. butzleri relate to human infections and pathogenesis?

A. butzleri has gained clinical significance as an emerging diarrheagenic pathogen associated with poultry and water reservoirs . During an 8-year study period, A. butzleri was identified as the fourth most common Campylobacter-like organism isolated from 67,599 stool specimens . The clinical presentation of A. butzleri infections resembles that of Campylobacter jejuni, but with some important distinctions:

Clinical FeatureA. butzleriC. jejuni
Diarrhea typePersistent, wateryOften bloody
PersistenceMore prolongedTypically self-limiting
Clinical severityVariableModerate to severe

Research methodologies for investigating A. butzleri pathogenesis include:

  • Clinical surveillance studies

  • Case-control comparisons

  • Animal infection models

  • Cell culture invasion and adherence assays

  • Multilocus sequence typing for strain tracking

What methodologies are most effective for measuring A. butzleri Lgt enzymatic activity in vitro?

The most effective methodology for measuring Lgt enzymatic activity involves tracking the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. A detailed protocol based on E. coli Lgt that can be adapted for A. butzleri Lgt includes:

  • Prepare a reaction mixture containing:

    • Purified recombinant Lgt protein

    • Peptide substrate (derived from a lipoprotein such as Pal, containing the conserved lipobox)

    • Phosphatidylglycerol substrate

    • Appropriate buffer conditions

  • Detect the released glycerol phosphate using a coupled luciferase reaction :

    • When Lgt catalyzes the reaction, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released

    • G3P can be detected through a coupled enzymatic reaction with G3P oxidase and horseradish peroxidase

    • Luminescence intensity correlates with Lgt enzymatic activity

  • Calculate IC50 values for potential inhibitors by measuring the decrease in luminescence signal

This assay has successfully identified potent Lgt inhibitors with IC50 values in the submicromolar range (e.g., G9066: 0.24 μM, G2823: 0.93 μM, G2824: 0.18 μM) .

How do inhibitors of Lgt affect A. butzleri compared to other Gram-negative bacteria?

Lgt inhibitors demonstrate bactericidal activity against multiple Gram-negative bacteria, including A. butzleri. Methodological approaches to compare inhibitor effects across bacterial species include:

  • Minimum Inhibitory Concentration (MIC) determination:

    • Prepare serial dilutions of Lgt inhibitors

    • Inoculate with standardized bacterial suspensions

    • Compare MIC values across A. butzleri, E. coli, and A. baumannii

  • Lipoprotein processing analysis:

    • Treat bacteria with sub-MIC concentrations of inhibitors

    • Extract cellular proteins for Western blot analysis

    • Detect accumulation of unprocessed prolipoproteins

    • Compare processing patterns across species

  • Membrane integrity assessment:

    • Measure outer membrane permeability using fluorescent dyes

    • Assess serum sensitivity of treated bacteria

    • Evaluate synergy with other antibiotics

Research findings indicate that unlike inhibitors targeting downstream steps in lipoprotein biosynthesis, Lgt inhibitors maintain efficacy even in strains with deletions of the major outer membrane lipoprotein (lpp) . This suggests that A. butzleri and other Gram-negative bacteria may share similar vulnerabilities to Lgt inhibition, though species-specific differences in lipoprotein utilization may influence susceptibility.

What is the relationship between Lgt function and antibiotic resistance in A. butzleri?

A. butzleri isolates exhibit variable antibiotic susceptibility profiles, with multiple antibiotic resistance genes (ARGs) identified in multidrug-resistant strains. The relationship between Lgt function and antibiotic resistance can be investigated through:

  • Genomic analysis:

    • Whole genome sequencing of resistant isolates

    • Identification of mutations in lgt and related lipoprotein processing genes

    • Correlation of lgt variations with resistance profiles

  • Phenotypic characterization:

    • Lgt depletion or inhibition studies

    • Assessment of changes in susceptibility to various antibiotic classes

    • Membrane permeability assays

  • Transcriptomic analysis:

    • RNA-seq of A. butzleri under Lgt inhibition

    • Identification of compensatory mechanisms

    • Comparison with other stress responses

Current research indicates that Lgt depletion in uropathogenic E. coli leads to increased sensitivity to serum killing and antibiotics due to outer membrane permeabilization . Given the similar role of Lgt in A. butzleri, its inhibition likely increases susceptibility to various antibiotics, particularly those normally excluded by an intact outer membrane.

What experimental approaches are most effective for studying Lgt-mediated lipoprotein processing in A. butzleri?

Several complementary approaches can be employed to study Lgt-mediated lipoprotein processing in A. butzleri:

  • Inducible gene deletion systems:

    • Create conditional lgt mutants using tetracycline-responsive promoters

    • Monitor growth and morphological changes under depletion conditions

    • Assess accumulation of unprocessed lipoproteins

  • SDS fractionation with Western blot analysis:

    • Separate peptidoglycan-associated proteins (PAP) from non-PAP fractions

    • Detect various forms of lipoproteins (e.g., Lpp) using specific antibodies

    • Identify pro-Lpp, diacylglyceryl-modified pro-Lpp (DGPLP), and mature forms

  • Pulse-chase experiments:

    • Label nascent proteins with radioactive amino acids

    • Chase with non-radioactive medium

    • Immunoprecipitate specific lipoproteins

    • Analyze processing kinetics by autoradiography

  • Mass spectrometry:

    • Extract membrane fractions

    • Identify lipid modifications on purified lipoproteins

    • Compare profiles under normal conditions versus Lgt inhibition

This multifaceted approach can reveal the specific consequences of Lgt disruption on lipoprotein processing and provide insights into potential compensatory mechanisms in A. butzleri.

How can MLST be used to correlate Lgt genetic variations with virulence in A. butzleri?

Multilocus sequence typing (MLST) has proven valuable for genotyping A. butzleri isolates and generating phylogenetic relationships. To correlate Lgt genetic variations with virulence:

  • MLST protocol for A. butzleri:

    • Amplify and sequence 7 housekeeping genes

    • Assign sequence types based on allelic profiles

    • Generate phylogenetic trees to determine evolutionary relationships

  • Lgt sequence analysis:

    • PCR-amplify and sequence the lgt gene from diverse isolates

    • Identify non-synonymous mutations and sequence variations

    • Map variations onto the phylogenetic framework

  • Virulence assessment:

    • Cell culture invasion assays

    • Adhesion to intestinal epithelial cells

    • Cytotoxicity measurements

    • Mouse colonization models

  • Statistical correlation:

    • Analyze associations between Lgt variants and virulence phenotypes

    • Account for other genetic factors using multivariate analysis

    • Identify specific mutations with functional consequences

Research has shown remarkable genetic diversity among A. butzleri isolates, with 44 different sequence types identified among 48 isolates in one study . This genetic diversity may extend to the lgt gene, potentially influencing virulence capabilities through altered lipoprotein processing efficiency.

What are the optimal conditions for expressing and purifying recombinant A. butzleri Lgt?

The expression and purification of recombinant A. butzleri Lgt presents challenges due to its multiple transmembrane domains. A systematic approach includes:

  • Expression system selection:

    • E. coli C43(DE3) or Lemo21(DE3) strains (designed for membrane proteins)

    • pET or pBAD vector systems with tunable expression

    • Fusion tags: His6, MBP, or SUMO to improve solubility

  • Optimization of expression conditions:

    • Lower induction temperature (16-20°C)

    • Reduced inducer concentration

    • Extended expression time (overnight)

    • Supplementation with additional phospholipids

  • Membrane protein extraction:

    • Gentle lysis methods to preserve membrane integrity

    • Detergent screening (DDM, LDAO, OG) for optimal solubilization

    • Lipid reconstitution approaches

  • Purification strategy:

    • Immobilized metal affinity chromatography

    • Size exclusion chromatography

    • Detergent exchange during purification

    • Activity verification at each purification step

The successful expression of active Lgt requires maintaining the protein in a membrane-like environment throughout purification, often necessitating the presence of appropriate detergents or lipid nanodiscs.

How can researchers address challenges in developing specific antibodies against A. butzleri Lgt?

Developing specific antibodies against A. butzleri Lgt presents several challenges due to its membrane-embedded nature and potential sequence conservation with other bacterial species. A methodological approach includes:

  • Antigen design strategies:

    • Hydrophilic loop regions predicted from topology models

    • Unique sequence regions distinguished from other bacterial Lgt homologs

    • Synthetic peptides coupled to carrier proteins

    • Recombinant protein fragments expressed in E. coli

  • Immunization protocols:

    • Multiple host species (rabbit, mouse, chicken) for diverse antibody repertoires

    • Extended immunization schedules with low antigen doses

    • CFA/IFA adjuvant systems for stronger responses

    • Prime-boost strategies with different antigen forms

  • Antibody purification and validation:

    • Affinity purification against immobilized antigen

    • Cross-adsorption against lysates from lgt-knockout bacteria

    • Validation by Western blot, ELISA, and immunoprecipitation

    • Specificity testing against related bacterial species

  • Alternative approaches:

    • Epitope tagging of recombinant Lgt for detection with commercial antibodies

    • Proximity labeling methods for studying Lgt interactions

    • Mass spectrometry-based approaches that don't rely on antibodies

These strategies can help overcome the inherent difficulties in generating specific antibodies against membrane proteins like Lgt.

How can A. butzleri Lgt inhibitors be developed as potential antimicrobial agents?

The development of A. butzleri Lgt inhibitors as antimicrobial agents follows a systematic drug discovery pipeline:

  • Target validation:

    • Confirm essentiality of lgt gene through conditional knockout studies

    • Demonstrate bactericidal effects of Lgt depletion or inhibition

    • Assess potential for resistance development

  • High-throughput screening approach:

    • Develop a miniaturized version of the glycerol phosphate release assay

    • Screen diverse chemical libraries against purified A. butzleri Lgt

    • Validate hits using secondary assays for specificity

  • Medicinal chemistry optimization:

    • Structure-activity relationship studies

    • Improvement of potency, selectivity, and physicochemical properties

    • Assessment of cytotoxicity against mammalian cells

  • In vivo efficacy testing:

    • Animal infection models

    • Pharmacokinetic and pharmacodynamic studies

    • Combination studies with existing antibiotics

Research findings indicate that Lgt inhibitors have several advantageous properties as antimicrobial candidates:

  • They exhibit bactericidal activity against wild-type A. baumannii and E. coli strains

  • Unlike inhibitors of downstream steps in lipoprotein biosynthesis, deletion of lpp is not sufficient to provide resistance to Lgt inhibitors

  • Lgt inhibition causes outer membrane permeabilization, potentially enhancing the efficacy of other antibiotics

These characteristics suggest that Lgt inhibitors may represent a promising new class of antimicrobials for treating infections caused by A. butzleri and other Gram-negative pathogens.

What diagnostic applications could be developed using A. butzleri Lgt as a biomarker?

A. butzleri Lgt has potential as a biomarker for diagnostic applications through several methodological approaches:

  • Antibody-based detection methods:

    • ELISA systems using anti-Lgt antibodies

    • Lateral flow assays for rapid point-of-care testing

    • Immunofluorescence for direct detection in clinical samples

  • Molecular diagnostic approaches:

    • PCR amplification of the lgt gene with species-specific primers

    • LAMP (Loop-mediated isothermal amplification) for resource-limited settings

    • Multiplex PCR panels including lgt and other virulence markers

  • Mass spectrometry applications:

    • MALDI-TOF detection of specific Lgt peptides

    • Identification of characteristic lipid modifications

  • Biosensor development:

    • Aptamer-based detection systems

    • Electrochemical impedance spectroscopy with immobilized antibodies

    • Surface plasmon resonance platforms

Given that A. butzleri was found to be the fourth most common Campylobacter-like organism in clinical samples , improved diagnostic methods could significantly enhance detection and appropriate treatment. The development of such diagnostics would be particularly valuable given that A. butzleri infections present with persistent, watery diarrhea that may be misdiagnosed as other enteric infections.

What are the critical knowledge gaps in understanding A. butzleri Lgt function compared to other bacterial species?

Several critical knowledge gaps exist in understanding A. butzleri Lgt function:

  • Structural characterization:

    • No crystal structure of A. butzleri Lgt is currently available

    • Substrate binding pocket architecture remains uncharacterized

    • Conformational changes during catalysis are poorly understood

  • Substrate specificity:

    • The repertoire of lipoproteins processed by A. butzleri Lgt is undefined

    • Potential differences in lipobox recognition compared to E. coli Lgt

    • Preferences for specific phospholipid substrates are unknown

  • Regulation mechanisms:

    • Transcriptional and post-translational regulation of lgt expression

    • Environmental factors affecting Lgt activity

    • Coordination with other lipoprotein processing enzymes

  • Role in pathogenesis:

    • Specific contributions of Lgt-processed lipoproteins to virulence

    • Impact on host immune recognition and evasion

    • Potential involvement in biofilm formation

Future research directions should focus on:

  • Comparative structural biology approaches to identify unique features of A. butzleri Lgt

  • Comprehensive lipoproteomic analysis under various growth conditions

  • Integration of Lgt function into broader models of outer membrane biogenesis

  • Investigation of Lgt as a potential vaccine target

How might A. butzleri Lgt interact with host immune systems during infection?

The interaction between A. butzleri Lgt-processed lipoproteins and host immune systems represents an important area for investigation:

  • Pattern recognition receptor activation:

    • TLR2 recognition of diacylated versus triacylated lipoproteins

    • NOD1/2 activation by peptidoglycan-associated lipoproteins

    • Inflammasome activation pathways

  • Methodological approaches:

    • Reporter cell lines expressing specific human TLRs

    • Primary immune cell stimulation assays

    • Cytokine profiling using multiplex platforms

    • In vivo infection models with immunological readouts

  • Immune evasion strategies:

    • Potential phase variation in lipoprotein expression

    • Modification of lipid moieties to alter immune recognition

    • Shedding of lipoproteins as decoys

  • Vaccination potential:

    • Recombinant Lgt-processed lipoproteins as vaccine candidates

    • Adjuvant properties of lipidated proteins

    • Cross-protection against multiple Arcobacter species

Understanding these interactions could provide insights into why A. butzleri infections typically present as persistent watery diarrhea rather than the more inflammatory bloody diarrhea seen with some other enteric pathogens . The distinct clinical presentation may reflect unique patterns of immune activation by A. butzleri lipoproteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.