Recombinant Arcobacter butzleri Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant A. butzleri HtpX is a full-length protease homolog expressed in Escherichia coli, derived from the htpX gene (locus Abu_1616) of A. butzleri strain RM4018 . Key properties include:

PropertyDetail
Uniprot IDA8EV91
Gene NamehtpX
Protein Length283 amino acids
Molecular Weight~32 kDa (calculated)
TagDetermined during production (typically His-tag or GST)
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C (short-term); -80°C (long-term)

Amino Acid Sequence

The full-length sequence (1–283 aa) is:
MEQTKTIFLLTFLTVIFVFFGYSFGGTNGmLIAFLIACGMNFYAYYYSDQQVLKHYNAIPLDDTKHPVYRITQKLTQKANLPMPKVYLIPDHTPNAFATGRNHEYAAVAVTIGLYEmLNEEELEGVIAHELSHIKHYDILIGTIAAVFAGAIAMIANMMQFSGMIGNNRQNSNPIVMIIMAILLPIAASIIQMTVSRSREYMADEGAARLTGNPAGLQSALGKLENYARSGHQINNATEQTAHMFIINPFSGLKSTLGALFRTHPTTADRIARLEELKSELRK .

Functional Domains

  • Contains conserved motifs of zinc-dependent metalloproteases, including a HEXXH metal-binding site .

  • Homolog of HtpX proteases involved in stress response and protein quality control in Gram-negative bacteria .

Production and Purification

The recombinant protein is synthesized in E. coli with the following protocols:

ParameterDetail
Expression HostEscherichia coli
Purification MethodAffinity chromatography (tag-dependent)
Purity>90% (SDS-PAGE verified)
Quality ControlMass spectrometry, endotoxin testing

Context in Arcobacter butzleri Research

A. butzleri strains like RM4018 and P1100 are clinically significant due to:

  • Antibiotic resistance genes: Strains harbor plasmids with bla OXA-464, tetA, and ermB .

  • Genetic diversity: 44 sequence types identified among 48 Ghanaian isolates, highlighting adaptive variability .

Challenges and Future Directions

  • Functional characterization: The role of HtpX in A. butzleri stress response or virulence remains unvalidated.

  • Therapeutic targeting: Protease inhibitors could be explored if HtpX is linked to pathogenicity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can fulfill specific format requests. Please indicate your desired format when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
htpX; Abu_1616; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Arcobacter butzleri (strain RM4018)
Target Names
htpX
Target Protein Sequence
MEQTKTIFLLTFLTVIFVFFGYSFGGTNGMLIAFLIACGMNFYAYYYSDQQVLKHYNAIP LDDTKHPVYRITQKLTQKANLPMPKVYLIPDHTPNAFATGRNHEYAAVAVTIGLYEMLNE EELEGVIAHELSHIKHYDILIGTIAAVFAGAIAMIANMMQFSGMIGNNRQNSNPIVMIIM AILLPIAASIIQMTVSRSREYMADEGAARLTGNPAGLQSALGKLENYARSGHQINNATEQ TAHMFIINPFSGLKSTLGALFRTHPTTADRIARLEELKSELRK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Arcobacter butzleri and why is htpX protein significant?

Arcobacter butzleri is a foodborne pathogen belonging to the Arcobacteraceae family. It is a Gram-negative bacterium typically found in water, food, and various organisms including farm animals, clams, and fish . A. butzleri has been isolated from human stool samples and is associated with gastrointestinal symptoms including diarrhea . The bacterium is taxonomically related to established pathogens such as Campylobacter jejuni and Helicobacter pylori .

The htpX protein (Protease HtpX homolog) is significant because it belongs to a family of zinc-dependent metallopeptidases typically involved in protein quality control within the cytoplasmic membrane. In bacterial systems, htpX often functions in stress response pathways, potentially contributing to virulence and environmental adaptation. Understanding htpX may provide insights into A. butzleri pathogenesis mechanisms and potential therapeutic targets.

What is the molecular structure and characteristics of A. butzleri htpX?

The recombinant A. butzleri htpX protein (UniProt accession: A8EV91) consists of 283 amino acids with the sequence: MEQTKTIFLLFTLTIFVFFGYSFFGTNGMLIAFLIAGMNFYAYYSDQQVLKHYNAIPLDDTKHPVYRITQKLTQKANLPMPKVYLIPDHTPNAFATGRNHEYAAVAVTIGLYEMLNEEEELEGVIAHELSHIKHYDILIGTIAAIFAGAIAMIIANMMQFSGMIGNNRQNSNPIVMIIMAILLPIAASIIQMTVSRSREYMADEGAARLTGNPAGLQSALGKLENYARSGHQINNATEQTAHMFIINPFSGLKSTLGALFRTHPTTADRIARLEELKSELRK .

The protein contains hydrophobic transmembrane domains characteristic of membrane proteases. Its sequence analysis suggests it possesses the conserved metalloprotease domain with the HEXXH zinc-binding motif typical of M50 peptidases. The protein is primarily expressed as a membrane-bound protease with its active site oriented toward the cytoplasm or periplasmic space, allowing it to cleave misfolded or damaged membrane proteins.

How does recombinant htpX differ from native htpX in A. butzleri?

Recombinant htpX from A. butzleri is produced through heterologous expression systems (typically E. coli) and may include affinity tags for purification purposes. The recombinant protein is generally designed to maintain the functional domains of native htpX while allowing for improved solubility, purification, and stability characteristics. The expressed protein may be modified with tags that could be determined during the production process .

Native htpX exists in its cellular environment with proper folding, post-translational modifications, and interactions with other cellular components. These natural interactions are crucial for understanding its complete biological function but are challenging to study directly. The recombinant version allows for isolated study of protein activity and structure but may not perfectly replicate all properties of the native protein, particularly membrane integration characteristics.

What are the recommended storage and handling conditions for recombinant htpX protein?

For optimal stability and activity retention, recombinant A. butzleri htpX should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein . For extended storage periods, conserving the protein at -20°C or -80°C is recommended . Working aliquots can be maintained at 4°C for up to one week, minimizing freeze-thaw cycles that could compromise protein integrity .

When handling the protein, researchers should avoid repeated freezing and thawing as this can lead to protein denaturation and loss of enzymatic activity. It is advisable to prepare appropriately sized aliquots during initial thawing to prevent repeated freeze-thaw cycles. Maintaining proper pH and avoiding harsh detergents or chaotropic agents unless specifically required for experimental protocols will help preserve protein structure and function.

What role might htpX play in A. butzleri virulence and pathogenesis?

While htpX has not been specifically identified among the primary virulence factors in published A. butzleri transcriptome analyses, its potential role in bacterial adaptation to host environments warrants investigation. Metalloproteases often contribute to bacterial stress responses, particularly during environmental transitions experienced during infection processes. The ability of A. butzleri to colonize intestinal epithelial models involves upregulation of several genes linked to stress response and environmental adaptation .

Transcriptome studies have demonstrated that several genes not previously considered virulence factors are differentially expressed during host-pathogen contact, particularly those involved in organic acid metabolism and iron transport . Given that htpX typically functions in stress response and membrane protein quality control, it may contribute to bacterial survival during colonization and infection. Its potential involvement in processing membrane proteins that interact with host cells or participate in evasion of host defenses represents an important avenue for investigation.

How does htpX compare to similar proteases across Epsilonproteobacteria?

A. butzleri's proteome has unexpected similarities to organisms beyond its immediate taxonomic family. While A. butzleri belongs to Campylobacteraceae, the majority of its proteome shows highest similarity to members of the Helicobacteraceae family, particularly Sulfuromonas denitrificans and Wolinella succinogenes, as well as deep-sea vent Epsilonproteobacteria like Sulfurovum and Nitratiruptor .

Comparative analysis of htpX across these related species reveals evolutionary patterns that may inform functional adaptations. The htpX of A. butzleri likely shares conserved metalloprotease domains with homologs in related species, but may contain unique structural features reflecting its specific functional adaptations. Approximately 61.5% of A. butzleri strain RM4018 proteins have their best matches in other Epsilonproteobacteria , suggesting that while core functional domains are conserved, species-specific adaptations have occurred that may influence substrate specificity or regulation of catalytic activity.

How might htpX function within the complex stress response network of A. butzleri?

Genome analysis of A. butzleri strain RM4018 reveals a substantial proportion of genes devoted to environmental adaptation, including numerous respiration-associated proteins, signal transduction and chemotaxis proteins, and proteins involved in DNA repair . The htpX protease likely functions within this broader network, potentially contributing to protein quality control under stressful conditions encountered during host infection.

Studies of related bacterial species suggest htpX often works in conjunction with other proteases such as FtsH to degrade misfolded membrane proteins, particularly under conditions of membrane stress. In A. butzleri, htpX may be integrated with systems involved in responding to oxidative stress, pH fluctuations, or antimicrobial compounds. Understanding these integrated pathways requires investigation of htpX expression patterns under various stress conditions, identification of interaction partners, and characterization of regulatory mechanisms that control its activity.

What genomic context surrounds htpX in A. butzleri and how might this inform its function?

The genomic organization surrounding htpX in A. butzleri provides important clues about its functional context. Within bacterial genomes, functionally related genes are often clustered together or organized in operons. The genome sequence of A. butzleri strain RM4018 revealed that approximately 30% of proteins with homologs in databases have their best matches to non-epsilonproteobacterial proteins, and these genes are clustered with respect to position and function .

Analysis of genes adjacent to htpX could reveal potential co-regulation, functional associations, or participation in shared biological pathways. If htpX is located near genes involved in stress response, membrane integrity, or virulence, this would strengthen hypotheses about its role in these processes. Additionally, the presence of transcription factor binding sites upstream of htpX would provide insights into its regulation under different environmental conditions.

What are the optimal expression systems for producing recombinant A. butzleri htpX?

When designing expression systems for A. butzleri htpX, researchers should consider both prokaryotic and eukaryotic options. E. coli-based systems (particularly BL21(DE3) strains) often provide efficient expression of bacterial proteins, though membrane-associated proteins like htpX present challenges. Codon optimization for E. coli expression may improve yields. For membrane proteins, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for toxic or membrane protein expression may provide advantages.

Alternative expression systems include:

Expression SystemAdvantagesChallenges
E. coli BL21(DE3)High yield, economical, rapidPotential improper folding of membrane proteins
E. coli C41/C43(DE3)Better for membrane proteinsLower yields than standard strains
Insect cell (Baculovirus)Better folding of complex proteinsHigher cost, longer production time
Cell-free systemsAvoids toxicity issuesLower yields, higher cost
Native A. butzleriAuthentic post-translational modificationsDifficult to culture, lower yields

For functional studies, inclusion of affinity tags (His6, GST, MBP) facilitates purification while fusion with fluorescent proteins (GFP) can aid in solubility assessment and localization studies. The placement of tags (N- or C-terminal) should be carefully considered to minimize interference with functional domains.

What assays are appropriate for measuring htpX protease activity?

As a putative zinc-dependent metalloprotease, htpX activity can be measured through several complementary approaches:

  • Fluorogenic peptide substrates: Synthetic peptides containing fluorophore-quencher pairs can be designed based on predicted cleavage specificities. Proteolytic cleavage separates the fluorophore from the quencher, resulting in measurable fluorescence increase.

  • SDS-PAGE analysis of substrate degradation: Incubating purified htpX with potential protein substrates followed by SDS-PAGE analysis can reveal proteolytic patterns through the appearance of degradation products.

  • FRET-based assays: Förster resonance energy transfer pairs can be incorporated into custom peptides, allowing real-time monitoring of proteolytic activity through changes in energy transfer efficiency.

  • Zymography: Incorporating potential substrates into polyacrylamide gels allows visualization of proteolytic activity as clear zones against a stained background.

Activity measurements should include appropriate controls:

  • Negative controls: Heat-inactivated enzyme, catalytic site mutants

  • Positive controls: Commercial proteases with known activity

  • Inhibitor controls: EDTA to chelate zinc, hydroxamate-based metalloprotease inhibitors

Optimal reaction conditions should be determined empirically, testing ranges of:

  • pH (typically 6.5-8.0 for metalloproteases)

  • Temperature (25-37°C)

  • Ionic strength (50-150 mM NaCl)

  • Metal cofactor concentration (0.1-1.0 mM ZnCl₂)

How can researchers effectively study htpX function in the context of A. butzleri pathogenesis?

To investigate htpX's role in A. butzleri pathogenesis, researchers should employ a multi-faceted approach combining molecular genetics, cellular models, and biochemical analyses:

  • Gene knockout/knockdown approaches:

    • CRISPR-Cas9 based deletion or targeted mutagenesis of htpX

    • Antisense RNA or RNAi approaches if transformation efficiency is low

    • Construction of conditional expression systems

  • Human intestinal cell models:

    • Mucus-producing intestinal in vitro models (Caco-2/HT29-MTX-E12) to study colonization and invasion abilities

    • Assessment of bacterial adherence, invasion, and cellular damage

    • Comparison of wild-type and htpX-deficient strains

  • Transcriptome and proteome analyses:

    • RNA-Seq to identify genes co-regulated with htpX under infection-relevant conditions

    • Proteomics to identify htpX substrates and interaction partners

    • Comparative analysis of wild-type and htpX-deficient strains

  • Stress response characterization:

    • Exposure to relevant stressors (acid, bile, oxidative stress, antimicrobials)

    • Assessment of survival, growth, and morphological changes

    • Quantification of stress-response marker expression

  • Complementation studies:

    • Reintroduction of wild-type htpX vs. catalytically inactive mutants

    • Cross-species complementation with htpX from related Epsilonproteobacteria

This integrated approach provides multiple lines of evidence regarding htpX function while controlling for potential compensatory mechanisms or pleiotropic effects.

What approaches can be used to identify physiological substrates of htpX?

Identifying the physiological substrates of htpX is crucial for understanding its biological function. Multiple complementary approaches should be employed:

  • Proteomics-based substrate identification:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) comparing wild-type and htpX-deficient strains

    • TAILS (Terminal Amine Isotopic Labeling of Substrates) to enrich for proteolytic fragments

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity-dependent biotin identification (BioID) using htpX-BirA fusions

  • Membrane protein enrichment:

    • Fractionation to isolate membrane proteins

    • Differential detergent extraction to separate membrane protein populations

    • Density gradient ultracentrifugation for membrane microdomain analysis

  • In vitro validation:

    • Synthesis of candidate substrate peptides

    • Site-directed mutagenesis of putative cleavage sites

    • Comparison of degradation patterns between wild-type and catalytically inactive htpX

  • Bioinformatic prediction:

    • Sequence motif analysis of identified substrates

    • Structural modeling of substrate-enzyme interactions

    • Integration of transcriptomic and proteomic data to identify co-regulated proteins

By integrating these approaches, researchers can build a comprehensive profile of htpX substrates and infer its biological roles in stress response and pathogenesis.

How should researchers interpret differences between in vitro and in vivo htpX activity?

Differences between in vitro and in vivo htpX activity are common and should be carefully interpreted. In vitro studies with recombinant htpX provide controlled conditions for measuring enzymatic parameters but may not fully reflect the protein's native environment. The following framework helps researchers interpret these differences:

ParameterIn vitro considerationsIn vivo considerationsReconciliation approaches
Substrate specificityLimited to tested substratesComplex mixture of potential targetsValidate in vitro findings with cell-based assays
Catalytic efficiencyMay be higher due to optimal conditionsModulated by cellular regulators and conditionsTest activity under physiologically relevant conditions
LocalizationSolution-phase or artificial membranesNative membrane integrationMembrane mimetics (nanodiscs, liposomes)
RegulationAbsent unless specifically includedComplex network of regulatory factorsSupplement assays with cellular fractions

For accurate interpretation, researchers should:

  • Validate in vitro findings with complementary in vivo approaches

  • Consider the membrane microenvironment when assessing activity

  • Account for potential interaction partners or regulators

  • Evaluate activity under conditions that mimic infection scenarios

Combining biochemical characterization with genetic approaches (e.g., complementation of htpX-deficient strains with mutant variants) provides the most robust framework for reconciling in vitro and in vivo observations.

What statistical approaches are appropriate for analyzing htpX expression data across different A. butzleri strains?

When analyzing htpX expression across different A. butzleri strains, researchers should employ robust statistical methods that account for biological variability and experimental design complexities:

  • For RT-qPCR data:

    • Relative quantification using the 2^(-ΔΔCt) method

    • Normalization with multiple reference genes validated for stability (geNorm, NormFinder)

    • ANOVA or mixed-effects models for multi-strain comparisons

    • Post-hoc tests with appropriate multiple testing correction (Bonferroni, Benjamini-Hochberg)

  • For RNA-Seq data:

    • Normalization methods (DESeq2, edgeR, or limma-voom)

    • Dispersion estimation appropriate for bacterial transcriptomes

    • Gene set enrichment analysis for pathway-level insights

    • Clustering approaches to identify co-regulated genes

  • For proteomics:

    • Appropriate normalization for label-free quantification

    • Peptide-to-protein roll-up strategies

    • Imputation methods for missing values

    • Statistical models that account for technical and biological variability

Studies have demonstrated strain-dependent variation in virulence gene expression among A. butzleri isolates , highlighting the importance of statistical approaches that account for strain-specific effects. Hierarchical or mixed models that explicitly incorporate strain as a random effect can provide insights into both strain-specific and conserved expression patterns.

How can researchers integrate multi-omics data to understand htpX function in the context of A. butzleri biology?

Understanding htpX function requires integration of multiple omics datasets. The following framework provides a structured approach to multi-omics integration:

  • Data layer integration:

    • Correlate transcriptomic changes in htpX with proteome alterations

    • Map metabolomic changes to enzymatic pathways potentially affected by htpX

    • Connect genomic variations in htpX across strains with phenotypic differences

  • Network-based approaches:

    • Construct protein-protein interaction networks centered on htpX

    • Identify enriched pathways affected by htpX perturbation

    • Apply graph theory algorithms to identify key nodes connected to htpX

  • Machine learning integration:

    • Supervised methods to predict htpX-dependent phenotypes

    • Feature selection to identify key molecular signatures

    • Unsupervised clustering to identify condition-specific htpX response patterns

  • Visualization strategies:

    • Multi-layer network visualizations

    • Sankey diagrams for pathway flows

    • Heatmaps with hierarchical clustering for expression patterns

Given that A. butzleri contains substantial genomic regions devoted to environmental adaptation , integrative approaches should especially consider htpX's potential role within stress response networks. The connections between htpX and systems for respiration, signal transduction, and DNA repair identified in genome analyses provide specific hypotheses that can be tested through multi-omics integration.

What considerations are important when comparing htpX function across different bacterial species?

Comparative analysis of htpX across bacterial species requires careful consideration of evolutionary, structural, and functional factors:

  • Evolutionary context:

    • While A. butzleri belongs to Campylobacteraceae, its proteome shows highest similarity to members of Helicobacteraceae and deep-sea vent Epsilonproteobacteria

    • Phylogenetic analyses should account for horizontal gene transfer events

    • Selective pressure analyses can identify conserved vs. rapidly evolving regions

  • Structural homology assessment:

    • Sequence similarity may not directly correlate with functional similarity

    • Critical catalytic residues must be conserved for functional equivalence

    • Transmembrane topology predictions should be compared across species

  • Genomic context:

    • Operon structure and co-localized genes often differ across species

    • Regulatory elements controlling expression vary significantly

    • Mobile genetic elements may influence functional adaptation

  • Physiological niche adaptation:

    • A. butzleri occupies diverse ecological niches unlike some specialist pathogens

    • Temperature, pH, and oxidative stress tolerance varies across species

    • Host interaction mechanisms differ between enteric pathogens

When designing cross-species complementation studies, researchers should consider:

  • Expression level matching through appropriate promoter selection

  • Codon optimization for heterologous expression

  • Membrane composition differences that may affect protein insertion and function

  • Potential interaction partner compatibility

These considerations allow for meaningful functional comparisons while accounting for species-specific adaptations that may influence htpX activity and regulation.

What are promising therapeutic applications targeting htpX in A. butzleri infections?

As an emerging pathogen associated with gastrointestinal illness, A. butzleri presents challenges for treatment, particularly given potential antibiotic resistance concerns. Targeting htpX offers several potential therapeutic strategies:

  • Small molecule inhibitor development:

    • Structure-based design targeting the metalloprotease active site

    • Allosteric inhibitors that modify protein conformation

    • Peptidomimetics that compete with natural substrates

  • Membrane-targeting approaches:

    • Compounds that disrupt htpX membrane integration

    • Peptides that interfere with substrate recognition

    • Molecules that alter membrane composition to indirectly affect htpX function

  • Anti-virulence strategies:

    • If htpX contributes to bacterial survival during infection, inhibitors could attenuate virulence without creating selective pressure for resistance

    • Combination therapies targeting htpX alongside other virulence mechanisms

  • Diagnostic applications:

    • htpX-specific antibodies for detection of A. butzleri in clinical samples

    • Activity-based probes to assess htpX functionality in clinical isolates

Future research should address:

  • Confirmation of htpX's role in A. butzleri pathogenesis

  • Structural characterization to enable rational inhibitor design

  • Validation of htpX inhibition effects on bacterial fitness and virulence

  • Delivery strategies for membrane-targeted therapeutics

How might CRISPR-Cas9 technology advance functional studies of htpX in A. butzleri?

CRISPR-Cas9 technologies offer transformative approaches for studying htpX function in A. butzleri:

  • Precise genetic manipulation:

    • Generation of clean deletions or point mutations in htpX

    • Introduction of epitope tags for protein tracking

    • Creation of conditional expression systems

    • Installation of reporter fusions for activity monitoring

  • Multiplexed genetic analysis:

    • Simultaneous targeting of htpX and potential interaction partners

    • Systematic perturbation of predicted regulatory pathways

    • Combinatorial modification of substrate candidates

  • CRISPRi approaches:

    • Tunable repression of htpX expression

    • Temporal control of knockdown to study different infection stages

    • Gradient repression to establish dose-dependent relationships

  • CRISPR-based screening:

    • Genome-wide screens to identify genetic interactions with htpX

    • Focused screens targeting membrane protein candidates

Implementation considerations include:

  • Optimization of transformation protocols for A. butzleri

  • Selection of appropriate promoters for Cas9 and guide RNA expression

  • Development of inducible systems for temporal control

  • Validation strategies to confirm on-target editing and minimize off-target effects

These CRISPR-based approaches would significantly accelerate understanding of htpX function by enabling precise genetic manipulations previously challenging in this organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.