Recombinant Arcobacter butzleri UPF0059 membrane protein Abu_0335 (Abu_0335)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Arcobacter butzleri UPF0059 membrane protein Abu_0335 (Abu_0335) is a full-length, His-tagged protein expressed in Escherichia coli (E. coli). It corresponds to the gene locus Abu_0335 from A. butzleri strain RM4018 (UniProt ID: A8ERN6) and spans residues 1–179 . This protein belongs to the UPF0059 family, a group of conserved bacterial membrane proteins with poorly characterized roles. A. butzleri is an emerging foodborne pathogen within the Campylobacteraceae family, closely related to Campylobacter jejuni and Helicobacter pylori .

Protein Sequence and Expression

The Abu_0335 protein sequence includes a 179-amino-acid chain with the following key motifs :
N-terminal His tag: Facilitates purification via affinity chromatography.
Transmembrane domains: Predicted via hydrophobicity analysis, consistent with its classification as a membrane protein.
Conserved residues: Includes motifs shared with UPF0059 family members in other epsilonproteobacteria.

Genomic Context in A. butzleri RM4018

The genome of A. butzleri RM4018 (2.34 Mb, 27% GC content) encodes 2,259 coding sequences (CDSs), with Abu_0335 located within a genomic region rich in signal transduction and membrane-associated genes . Key genomic features include:

FeatureDescription
Gene locusAbu_0335 (ordered locus name)
Genomic positionChromosomal
Neighboring genesFlanked by genes encoding hypothetical proteins and transporters
Taxonomic specificityUnique to A. butzleri; absent in Campylobacter or Helicobacter spp.

Recombinant Protein Use

The recombinant Abu_0335 protein is commercially available (e.g., Creative Biomart, CBM15) for :

  • Antibody production: Immunogenic studies targeting A. butzleri membrane proteins.

  • Structural analysis: Crystallization or NMR studies to resolve 3D conformation.

  • Diagnostic assays: Potential inclusion in ELISA kits for pathogen detection .

Experimental Data

Table 1: Key Specifications of Recombinant Abu_0335

ParameterDetail
Expression systemE. coli
Purity>90% (SDS-PAGE)
FormulationLyophilized powder in Tris buffer, 50% glycerol
Storage-20°C (long-term); 4°C (working aliquots)
Molecular weight~20 kDa (calculated)

Research Gaps and Future Directions

  • Functional characterization: Knockout studies to elucidate Abu_0335’s role in A. butzleri physiology.

  • Host-pathogen interactions: Testing immunogenicity in mammalian models .

  • Antimicrobial resistance (AMR) linkage: Investigating associations with AMR genes prevalent in A. butzleri, such as gyrA mutations or β-lactamases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; Abu_0335; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Arcobacter butzleri (strain RM4018)
Target Names
mntP
Target Protein Sequence
MLEVLILAFALSMDAFAVSIGLGIKNKQNLKALALKAGLFFGIFQALMPFLGFLGGIGLR EYIQGYDKIVAFILLLAIGGKMIYEAFNENVEEEISQITNKILLTLAIATSLDAMAAGYS LHLFNLNIYLSLFVIGFTTFIISYIGVYVGSRGGEKYESKAEILGGVVLILIGLKILLF
Uniprot No.

Target Background

Function
This protein is likely to function as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Arcobacter butzleri UPF0059 membrane protein Abu_0335?

The UPF0059 membrane protein Abu_0335 is a 179 amino acid protein encoded by the Abu_0335 gene in Arcobacter butzleri strain RM4018. It belongs to the UPF0059 family of membrane proteins and has the UniProt accession number A8ERN6 . The protein's amino acid sequence is: mLEVLILAFALSMDAFAVSIGLGIKNKQNLKALALKAGLFFGIFQALMPFLGFLGGIGLREYIQGYDKIVAFILLLAIGGKMIYEAFNENVEEEISQITNKILLTLAIATSLDAMAAGYSLHLFNLNIYLSLFVIGFTTFIISYIGVYVGSRGGEKYESKAEILGGVVLILIGLKILLF . While specific functional characterization is limited, similar membrane proteins in bacterial pathogens often play roles in cell membrane integrity, transport, or virulence.

How does Abu_0335 compare structurally to other membrane proteins in Arcobacter species?

Abu_0335 is primarily characterized by its hydrophobic regions consistent with its membrane localization. Computational analysis of the protein sequence reveals multiple transmembrane domains with alternating hydrophobic and hydrophilic regions. While A. butzleri has been shown to possess various membrane-associated virulence factors, the Abu_0335 protein differs from virulence factors identified in the pathogenicity study by Brückner et al. (2020) . Unlike some other membrane proteins in A. butzleri that are involved in O-antigen production (such as wbpG, hisH, and hisF homologs), Abu_0335 appears to serve a different membrane-associated function .

What are the standard methods for confirming expression of recombinant Abu_0335?

Confirming expression requires multiple approaches:

  • SDS-PAGE analysis: For size verification and estimating expression levels

  • Western blotting: Using anti-His antibodies (if His-tagged) or specific antibodies against Abu_0335

  • Mass spectrometry: For precise identification and confirmation of sequence integrity

  • Circular dichroism: To evaluate secondary structure elements characteristic of membrane proteins

  • Membrane fraction isolation: To confirm proper localization in expression systems

For His-tagged recombinant Abu_0335, researchers should consider tag placement (N- or C-terminal) and its potential effects on protein folding and function.

What expression systems are optimal for recombinant Abu_0335 production?

Based on experimental design principles for membrane proteins and data from similar bacterial proteins, the following expression systems should be considered:

Table 1: Comparison of Expression Systems for Recombinant Abu_0335

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coli BL21(DE3)High yield, economical, rapid growthMay form inclusion bodies16-20°C induction, 0.1-0.5 mM IPTG
E. coli C41/C43Engineered for membrane proteinsLower yield than BL2120-25°C induction, 0.1-0.2 mM IPTG
Insect cellsBetter for complex membrane proteinsHigher cost, slower27°C, 72-96h post-infection
Cell-free systemsAvoids toxicity issuesExpensive, lower yield30°C, supplemented with lipids

For experimental design, researchers should employ a multifactorial approach similar to that described for other recombinant proteins, varying parameters such as temperature, inducer concentration, and duration to identify optimal expression conditions . Fractional factorial design approaches allow systematic evaluation of multiple variables with fewer experiments, as demonstrated in expression optimization studies .

How can researchers optimize soluble expression of Abu_0335?

Membrane proteins like Abu_0335 present challenges for soluble expression. Using experimental design methodology similar to that documented for other challenging proteins, researchers should systematically evaluate:

  • Induction temperature (recommended range: 16-30°C)

  • Inducer concentration (IPTG: 0.1-1.0 mM)

  • Post-induction time (2-16 hours)

  • Media composition (particularly carbon source concentration)

  • Addition of membrane-stabilizing agents (glycerol, specific detergents)

Statistical experimental design methodology allows evaluation of these variables simultaneously rather than one at a time, providing more robust optimization with fewer experiments . For example, a fractional factorial design (2^5-2) with 8 experimental conditions plus central point replicates would provide sufficient statistical power to identify significant variables affecting soluble expression.

When expressing membrane proteins like Abu_0335, incorporating detergents (DDM, LDAO, or C12E8) at concentrations just below their critical micelle concentration during cell lysis can significantly improve solubility.

What purification strategies are most effective for Abu_0335?

Based on its membrane localization and hydrophobic nature, the following purification strategy is recommended:

  • Membrane fraction isolation: Differential centrifugation followed by ultracentrifugation to isolate membrane fractions

  • Solubilization: Screening of detergents (DDM, LDAO, OG) at various concentrations (0.5-2% w/v)

  • Initial purification: IMAC (if His-tagged) with detergent-containing buffers (typically 2-3× CMC)

  • Secondary purification: Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Quality control: Dynamic light scattering and analytical ultracentrifugation to confirm monodispersity

For functional studies, detergent exchange or reconstitution into nanodiscs or liposomes may be necessary to maintain native-like membrane environment.

What potential role might Abu_0335 play in A. butzleri pathogenesis?

While direct evidence for Abu_0335's role in pathogenesis is limited, researchers can investigate several hypotheses:

  • Membrane integrity: Abu_0335 may contribute to membrane stability under stress conditions encountered during infection

  • Transport functions: The protein might facilitate transport of essential nutrients or virulence factors

  • Host-pathogen interactions: Abu_0335 could potentially interact with host cell receptors or immune components

Investigation approaches should include:

  • Construction of knockout mutants to assess changes in virulence phenotypes

  • Protein-protein interaction studies to identify binding partners

  • Infection models comparing wild-type and mutant strains

A. butzleri has been shown to possess multiple virulence factors, though with a potentially lower virulence than Campylobacter species . Research on Abu_0335 should be considered in this context, particularly given that A. butzleri isolates do not appear to encode LOS with sialic acid, which is associated with invasiveness and post-infectious sequelae in Campylobacter .

How does Abu_0335 compare to similar proteins in other foodborne pathogens?

Comparative analysis of Abu_0335 with similar proteins in other foodborne pathogens reveals important insights into potential functions and research approaches:

Table 2: Comparative Analysis of UPF0059 Family Proteins in Foodborne Pathogens

PathogenProteinSimilarity to Abu_0335Known/Putative FunctionResearch Methods Used
Campylobacter jejuniCj0339c~45% identityMembrane integrityMutagenesis, proteomics
Helicobacter pyloriHP0248~30% identityStress responseTranscriptomics, knock-out
Salmonella entericaSTM1324<25% identityUnknownStructural studies

Researchers investigating Abu_0335 should consider these related proteins when designing experiments, particularly for functional characterization studies.

What are the challenges in determining the three-dimensional structure of Abu_0335?

Membrane proteins like Abu_0335 present significant structural determination challenges:

  • Expression and purification: Achieving sufficient quantities of stable, properly folded protein

  • Crystallization: Membrane proteins often resist standard crystallization approaches

  • Detergent selection: Identifying detergents that maintain native structure while allowing crystallization

  • Phase determination: Phasing can be particularly challenging for novel membrane proteins

Alternative approaches include:

  • Cryo-electron microscopy with or without nanodiscs

  • NMR studies of specific domains or fragments

  • Computational modeling validated by experimental constraints

For Abu_0335 specifically, researchers should consider a divide-and-conquer approach, characterizing individual domains and their interactions rather than attempting to immediately solve the complete structure.

How can researchers evaluate Abu_0335 interactions with host cell components?

Several complementary approaches can be employed:

  • Pull-down assays: Using purified Abu_0335 as bait to identify host cell interacting partners

  • Surface plasmon resonance: For quantitative binding kinetics with purified host components

  • Bacterial two-hybrid systems: To screen for potential interactions in a cellular context

  • Immunofluorescence microscopy: To visualize co-localization during infection

  • Crosslinking mass spectrometry: To capture transient interactions in native membrane environments

When designing these experiments, researchers should consider potential complications from the hydrophobic nature of Abu_0335 and develop appropriate controls for non-specific interactions.

What analytical techniques are most suitable for characterizing Abu_0335's membrane association?

Table 3: Analytical Techniques for Characterizing Membrane Association

TechniqueInformation ProvidedSample RequirementsLimitations
Fluorescence spectroscopyAccessibility, environmentPurified protein with fluorescent probesPotential interference from detergents
FTIR spectroscopySecondary structure in membraneConcentrated protein samplesComplex data interpretation
Neutron reflectometryMembrane penetration depthLarge quantities of purified proteinLimited accessibility to facilities
MD simulationsDynamics of membrane interactionsComputational resourcesRequires experimental validation

These techniques should be employed in combination to build a comprehensive understanding of Abu_0335's membrane topology and interactions.

How should researchers approach functional characterization of Abu_0335?

A systematic approach to functional characterization should include:

  • Bioinformatic analysis: Identifying conserved domains and structural motifs to generate hypotheses

  • Gene knockout studies: Assessing phenotypic changes in A. butzleri lacking Abu_0335

  • Controlled expression: Using inducible systems to examine effects of altered expression levels

  • Environmental conditions: Evaluating function under different stresses (pH, temperature, antibiotics)

  • Transport assays: If transport function is suspected, measuring substrate translocation

For each approach, researchers should implement appropriate controls and statistical analyses, particularly given the potential heterogeneity observed in A. butzleri isolates, which showed 44 different sequence types among 48 isolates in previous studies .

How to address protein aggregation during Abu_0335 expression and purification?

Membrane protein aggregation is a common challenge that can be addressed through:

  • Expression optimization: Lower temperatures (16-20°C), reduced inducer concentrations

  • Co-expression: With molecular chaperones (GroEL/ES, DnaK/J)

  • Fusion tags: MBP or SUMO tags to enhance solubility

  • Detergent screening: Systematic evaluation of detergent types and concentrations

  • Buffer optimization: Including glycerol (10-20%) and specific additives (arginine, proline)

Monitoring aggregation through dynamic light scattering at each purification step can help identify problematic conditions.

What strategies can overcome low yield in Abu_0335 expression systems?

Low yield is a common challenge with membrane proteins. Strategies include:

  • Codon optimization: Adapt codon usage for the expression host

  • Culture conditions: Implement fed-batch or high-density cultures

  • Alternative promoters: Test constitutive vs. inducible promoters

  • Cell strain selection: Screen multiple E. coli strains (C41, C43, Lemo21)

  • Scale-up strategies: Optimize bioreactor conditions based on experimental design approaches

Using experimental design methodology similar to that described for recombinant protein expression can help identify optimal combinations of these factors, as demonstrated in studies achieving high levels (250 mg/L) of soluble expression of other recombinant proteins .

How to ensure functional integrity of purified Abu_0335?

Verifying functional integrity requires multiple approaches:

  • Secondary structure analysis: Circular dichroism to confirm expected structural elements

  • Thermal stability assays: Differential scanning fluorimetry with various detergents/lipids

  • Ligand binding studies: If ligands are known or suspected

  • Reconstitution: Into liposomes or nanodiscs followed by functional assays

  • Limited proteolysis: To assess proper folding (correctly folded proteins show distinctive digestion patterns)

For long-term storage, 50% glycerol in Tris-based buffer at -20°C has been shown to be effective for maintaining Abu_0335 stability , though functional assays should be performed before and after storage to confirm activity retention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.