Recombinant Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant ArgO is produced through heterologous expression systems, including E. coli, yeast, and cell-free platforms, to enable structural and functional studies. Key production details include:

ParameterSpecification
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression systems
Purity>85% (SDS-PAGE)
TagsN-terminal or C-terminal tags for stability and purification
StorageTris-based buffer with 50% glycerol; store at -20°C to -80°C
Species VariantsE. coli K12 (UniProt ID: P11667) and Enterobacter sp. 638 (UniProt ID: A4WE68)

Topology

  • ArgO adopts an N<sub>in</sub>-C<sub>out</sub> topology with five transmembrane helices, a cytoplasmic N-terminal domain (NTD), and a periplasmic C-terminal region (CTR) .

  • The NTD (residues 1–43) is essential for function, while the CTR is dispensable .

  • Conserved aspartate residues (e.g., D45 and D198 in E. coli) are critical for arginine transport .

Mechanism

  • Functions as a monomer to form an arginine-translocating conduit, energized by the proton motive force (PMF) .

  • Exports arginine and its antimetabolite canavanine, protecting cells from toxicity .

Regulation by ArgP and Lrp

  • Transcription of argO is activated by ArgP (a LysR-type regulator) in response to intracellular arginine .

  • Lysine competitively inhibits ArgP binding, repressing argO expression .

  • The global regulator Lrp (leucine-responsive regulatory protein) competitively activates argO under low arginine conditions .

Promoter Dynamics

  • ArgP binds to the argO promoter region (-85 to -20), overlapping the -35 RNA polymerase binding site .

  • Arginine-loaded ArgP recruits RNA polymerase to initiate transcription, while lysine-loaded ArgP forms nonproductive complexes .

Metabolic Engineering Applications

  • Overexpression of argO in E. coli triples arginine production (11.64 g/L in batch fermentation) by alleviating feedback inhibition and enhancing export .

  • Strains with argO and feedback-resistant argA214 (N-acetylglutamate synthase) achieve a product yield of 0.17 g arg/g glucose .

StrainModificationsArginine Titer (g/L)Productivity (g/L/h)
SJB009argO overexpression + argA21411.640.24
SJB010argP216 (hyperactive ArgP) + argA2147.450.29

Industrial Biotechnology

  • Used in arginine-overproducing strains for pharmaceutical and nutraceutical industries .

  • Critical for bypassing metabolic bottlenecks in microbial cell factories .

Research Reagents

  • Commercial variants (e.g., BioCrick BCP19883 and BCP19894) are available for membrane protein studies and transporter assays .

Challenges and Future Directions

  • Low Solubility: Requires optimization of expression conditions for structural studies .

  • Regulatory Complexity: Fine-tuning argO expression with ArgP/Lrp interplay remains challenging .

  • Host Compatibility: Expanding production to non-E. coli hosts (e.g., Corynebacterium glutamicum) for industrial scalability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize development accordingly.
Synonyms
argO; YPTB3193; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
argO
Target Protein Sequence
MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL
Uniprot No.

Target Background

Function
ArgO plays a crucial role in the export of arginine. It is essential for maintaining the correct intracellular arginine level and the delicate balance between arginine and lysine.
Database Links
Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArgO and what is its primary function?

ArgO (previously known as yggA) is an arginine exporter protein in Escherichia coli that mediates the efflux of arginine from the bacterial cell. The protein shares significant sequence similarity with the basic amino acid exporter LysE of Corynebacterium glutamicum. Experimental evidence has confirmed increased arginine efflux from E. coli strains with either the argPd mutation or multicopy yggA+, while null yggA mutation abolishes this increased arginine efflux . The physiological function of ArgO appears to be either preventing the accumulation of toxic levels of arginine or its analog canavanine (a plant-derived antimetabolite), or maintaining an appropriate balance between intracellular lysine and arginine concentrations .

How is ArgO regulated at the transcriptional level?

ArgO expression is primarily regulated by two transcription factors: ArgP and Lrp, creating a complex regulatory network:

  • ArgP regulation: The argO gene is under the transcriptional control of ArgP (previously called iciA), a LysR-type transcriptional regulator protein. ArgO expression exhibits ArgP-dependent induction by arginine, with lysine supplementation virtually abolishing argO expression even in ArgP+ strains .

  • Lrp regulation: The global transcriptional regulator Lrp activates the argO promoter approximately fourfold. This activation is antagonized, but not completely eliminated, by the presence of exogenous leucine .

  • Competitive regulation: In vivo and in vitro analyses indicate that Lrp and ArgP interfere with each other's binding to overlapping targets in the argO control region. As a consequence, each regulator acts more potently in the absence of the other, creating a competitive activation mechanism that appears to be rare in bacterial transcription regulation .

What are the key structural features of ArgO that enable its function?

While the search results don't provide specific structural information about ArgO, we can infer some properties based on its function and homology. ArgO shares similarity with the basic amino acid exporter LysE of Corynebacterium glutamicum, suggesting similar structural components for membrane transport . As a membrane protein, ArgO likely contains multiple transmembrane domains that form a channel or pore through which arginine is exported from the cytoplasm to the extracellular space. The protein must have specific binding sites for arginine recognition and mechanisms for facilitating its directional transport across the membrane.

How can ArgO activity be measured in laboratory settings?

The activity of ArgO can be measured through several experimental approaches:

Arginine cross-feeding assay: This involves using an arginine auxotrophic strain (e.g., ΔargH strain) on minimal media supplemented with all requirements except arginine. Test strains expressing ArgO are spotted on the agar surface, and arginine cross-feeding is visualized as red haloes of syntrophic growth of the auxotrophic strain around the spots, indicating arginine export .

Amperometric biosensors: L-arginine oxidase (ArgO) isolated from the mushroom Amanita phalloides can be co-immobilized with peroxidase-like nanozymes on graphite electrodes to create biosensors for direct measurement of arginine. These biosensors exhibit high sensitivity and selectivity to arginine, with broad linear ranges and good storage stability .

Direct measurement of arginine efflux: This can be performed using radiolabeled arginine to track its movement across the cell membrane, comparing wild-type cells with those overexpressing ArgO or carrying mutations in regulatory proteins like ArgP.

What expression systems are most effective for producing recombinant ArgO?

For successful recombinant production of ArgO, researchers should consider:

  • Expression host: E. coli is the natural host of ArgO and therefore an appropriate expression system, especially for functional studies. Common laboratory strains like BL21(DE3) or its derivatives are suitable for membrane protein expression.

  • Expression vectors: Vectors with tunable expression, such as those with the T7 promoter or arabinose-inducible systems, allow control over expression levels which is crucial for membrane proteins that can be toxic when overexpressed.

  • Fusion tags: Addition of tags like His6 or other affinity tags facilitates purification. For membrane proteins like ArgO, these tags should be placed at positions that don't interfere with membrane insertion or transport function.

  • Growth conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often result in better folding and less aggregation of membrane proteins.

  • Membrane extraction: Appropriate detergents must be selected for solubilization of ArgO from membranes without denaturing the protein.

What methodologies are recommended for studying the ArgO-ArgP regulatory interaction?

To investigate the regulatory interaction between ArgO and ArgP, several methodologies can be employed:

Reporter gene assays: Using argO-lac fusion constructs to measure argO promoter activity under various conditions. This approach has demonstrated that argO-lac expression exhibits ArgP-dependent induction by arginine, while lysine supplementation virtually abolishes argO expression .

Gel shift assays (EMSA): To detect direct binding of ArgP to the argO promoter region and how this binding is affected by arginine, lysine, or their analogs.

DNase footprinting: This technique can identify the specific DNA sequences where ArgP binds in the argO regulatory region.

Chromatin immunoprecipitation (ChIP): To study the ArgP-DNA interaction in vivo.

In vitro transcription assays: To directly measure the effect of ArgP on argO transcription using purified components.

Competitive binding studies: To evaluate how ArgP and Lrp interact with the argO promoter and compete for binding sites, given that these regulators interfere with each other's binding to overlapping targets .

How do ArgP and Lrp coordinately regulate ArgO expression?

The regulation of argO by ArgP and Lrp represents an interesting case of competitive activation:

Binding mechanism: Dimeric Lrp binds cooperatively to at least three regularly spaced semi-palindromic binding sites in the argO control region. Leucine reduces complex formation approximately twofold but concomitantly enhances the cooperativity of binding .

Structural changes: Footprinting data suggest a severe Lrp-induced deformation of the argO control region, indicating that DNA bending may play a role in the regulatory mechanism .

Competitive activation: ArgP and Lrp bind to overlapping targets in the argO promoter region, resulting in mutual inhibitory binding. As a consequence, each regulator acts more potently in the absence of the other, creating a rare mechanism of competitive activation of a single promoter by two activator proteins .

Environmental response: The effector-modulated activation of argO transcription by ArgP and Lrp ensures an adapted and fine-tuned synthesis of the transporter in response to varying environmental conditions, particularly amino acid availability .

What is the relationship between ArgO function and canavanine resistance in bacteria?

The relationship between ArgO and canavanine resistance involves several key aspects:

Canavanine sensitivity: Strains with null mutations in either argO or argP exhibit supersensitivity to the arginine analog canavanine (CanSS phenotype) . This suggests that the inability to export canavanine leads to its accumulation to toxic levels within the cell.

Resistance mechanisms: Dominant missense mutations in argP (argPd) confer canavanine resistance (CanR phenotype) and render argO-lac expression constitutive . This indicates that constitutive activation of ArgO expression leads to enhanced export of canavanine, reducing its intracellular concentration below toxic levels.

Physiological significance: The plant-derived antimetabolite canavanine is structurally similar to arginine and can be incorporated into proteins, causing misfolding and functional defects. The ability to export canavanine via ArgO represents an important defense mechanism against this natural toxin .

Evolutionary context: The conservation of this export system suggests that E. coli and related bacteria have evolved mechanisms to cope with plant-derived toxins that they might encounter in their natural environments.

How does ArgO contribute to arginine homeostasis in bacteria?

ArgO plays a crucial role in maintaining arginine homeostasis through several mechanisms:

Export of excess arginine: ArgO prevents the accumulation of arginine to potentially toxic levels by exporting it from the cell when internal concentrations are high .

Balance with lysine: One proposed physiological function of ArgO is to maintain an appropriate balance between intracellular lysine and arginine concentrations . This is supported by the observation that lysine supplementation virtually abolishes argO expression, suggesting a regulatory crosstalk between these two basic amino acids .

Integration with metabolic networks: The regulation of ArgO by both ArgP and Lrp, which respond to different metabolic cues, allows the cell to fine-tune arginine export in response to various environmental and metabolic conditions .

Feedback regulation: The induction of argO expression by arginine creates a feedback loop that helps maintain arginine within optimal intracellular concentrations, ensuring it is available for protein synthesis but not at levels that might disrupt cellular processes.

What are common challenges in studying membrane proteins like ArgO?

Researchers working with ArgO and similar membrane proteins face several technical challenges:

Expression and purification: Membrane proteins often express at low levels and can be toxic when overexpressed. Strategies to overcome this include:

  • Using specialized E. coli strains designed for membrane protein expression

  • Lowering expression temperature to 16-20°C

  • Using weaker promoters or lower inducer concentrations

  • Testing different detergents for optimal solubilization without denaturation

Functional assays: Maintaining protein function during purification and reconstitution is challenging. Researchers should:

  • Verify protein functionality after each purification step

  • Consider using proteoliposomes for functional studies

  • Develop reliable activity assays specific to ArgO's transport function

Structural studies: Obtaining structural information for membrane proteins is notoriously difficult. Approaches include:

  • Cryo-electron microscopy, which has recently become more accessible for membrane protein structure determination

  • X-ray crystallography with appropriate crystallization detergents and conditions

  • Computational modeling based on homologous proteins

Protein-protein interactions: Studying interactions between ArgO and regulatory proteins requires maintaining the native membrane environment. Techniques like:

  • Crosslinking

  • Co-immunoprecipitation with mild detergents

  • Fluorescence resonance energy transfer (FRET)
    may provide insights into these interactions.

How can researchers distinguish between direct and indirect effects in ArgO regulation studies?

Distinguishing direct from indirect effects in regulatory studies requires multiple complementary approaches:

In vitro reconstitution: Using purified components (ArgP, Lrp, RNA polymerase, and the argO promoter) in transcription assays can establish direct regulatory effects.

Mutation analysis: Site-directed mutagenesis of specific binding sites in the argO promoter can confirm direct interactions. For example, mutations that specifically disrupt ArgP binding but not Lrp binding can help delineate their individual contributions.

Temporal studies: Analyzing the kinetics of responses can help distinguish direct from indirect effects. Direct regulation typically occurs more rapidly than indirect regulation involving multiple steps.

Epistasis analysis: Studying double mutants (e.g., argP/lrp double mutant) and comparing phenotypes with single mutants can reveal regulatory hierarchies and distinguish direct from indirect effects.

Inducible systems: Using inducible expression systems with translational inhibitors can help separate transcriptional from post-transcriptional effects.

What are the best experimental designs for studying ArgO-mediated arginine transport?

To effectively study ArgO-mediated arginine transport, researchers should consider these experimental designs:

Genetic approaches:

  • Comparison of arginine export in wild-type, ΔargO, and ArgO-overexpressing strains

  • Construction of point mutants targeting potential arginine binding or channel-forming residues

  • Creation of chimeric proteins with other transporters to identify functional domains

Biochemical approaches:

  • Reconstitution of purified ArgO into proteoliposomes for direct transport assays

  • Radiolabeled arginine flux measurements in whole cells versus membrane vesicles

  • Competition assays with arginine analogs to determine substrate specificity

Structural approaches:

  • Site-directed spin labeling coupled with electron paramagnetic resonance for conformational studies

  • Accessibility studies using cysteine scanning mutagenesis

  • Fluorescence-based assays to monitor conformational changes during transport

Physiological relevance:

  • Growth experiments under various arginine concentrations

  • Stress response assays to determine how ArgO contributes to tolerance of high arginine or canavanine concentrations

  • Measurement of intracellular versus extracellular arginine ratios in different genetic backgrounds

How should researchers interpret contradictory results in ArgO studies?

When encountering contradictory results in ArgO research, consider the following analytical framework:

Experimental conditions: Differences in growth media, strain backgrounds, and environmental conditions can significantly impact ArgO expression and function. Analyze whether contradictions arise from:

  • Different E. coli strain backgrounds (K-12, B, W, etc.)

  • Variations in growth media composition, particularly amino acid content

  • Growth phase differences (exponential vs. stationary)

  • Aerobic versus anaerobic conditions

Genetic context: The presence of suppressor mutations or differences in genetic background can lead to contradictory results. Consider:

  • Sequencing key regulatory genes (argP, lrp) in your strains

  • Whole genome sequencing to identify potential suppressor mutations

  • Creating clean genetic backgrounds through P1 transduction

Molecular mechanisms: Apparent contradictions may reflect the complexity of ArgO regulation:

  • The competitive binding of ArgP and Lrp could lead to context-dependent effects

  • Post-transcriptional regulation not yet characterized

  • Potential involvement of small RNAs or other regulators

Methodological differences: Different assay systems may measure different aspects of ArgO function:

  • Transport assays versus reporter gene assays

  • In vivo versus in vitro systems

  • Different detection methods with varying sensitivities

What statistical approaches are most appropriate for analyzing ArgO transport data?

For robust analysis of ArgO transport data, consider these statistical approaches:

For dose-response relationships:

  • Non-linear regression to determine Km and Vmax values for arginine transport

  • Hill equation analysis to detect potential cooperativity in transport

  • Comparison of kinetic parameters using extra sum-of-squares F test

For comparing multiple conditions:

  • ANOVA followed by appropriate post-hoc tests (Tukey, Dunnett, etc.) when comparing multiple experimental conditions

  • Mixed-effects models when dealing with repeated measures or hierarchical data structures

For time-course experiments:

  • Area under the curve (AUC) analysis for cumulative transport

  • Repeated measures ANOVA or mixed models for time series data

  • Non-linear models to extract rate constants

For biotechnological applications:

  • Response surface methodology to optimize expression conditions

  • Principal component analysis for multivariate data from biosensor applications

For reproducibility assessment:

  • Calculation of coefficient of variation (CV) to assess assay reproducibility

  • Bootstrapping approaches for robust confidence interval estimation

  • Bland-Altman plots to compare different measurement methods

How can researchers quantitatively compare the effects of different regulators on ArgO expression?

To quantitatively compare how different regulators (such as ArgP and Lrp) affect ArgO expression, researchers should consider these approaches:

Reporter systems:

  • Use the same reporter construct (e.g., argO-lacZ fusion) across all experiments

  • Ensure measurements are taken in the linear range of the assay

  • Calculate fold-change relative to a consistent control condition

Quantitative framework:

  • Develop mathematical models that incorporate the binding affinities, cooperativity, and competition between regulators

  • Use thermodynamic models of transcriptional regulation to predict occupancy of the argO promoter under different conditions

  • Apply systems biology approaches to integrate multiple regulatory inputs

Experimental design:

  • Factorial experiments that systematically vary the levels of multiple regulators

  • Titration experiments with inducible expression systems for each regulator

  • Creation of a regulatory series (wild-type, single deletions, double deletions, constitutive variants)

Data visualization:

  • Heat maps showing ArgO expression across combinations of regulator levels

  • Three-dimensional response surfaces for visualizing interactions between regulators

  • Network diagrams showing the strength and direction of regulatory interactions

What are promising applications of ArgO in biotechnology?

ArgO has several potential biotechnological applications:

Biosensors for arginine detection:
L-arginine oxidase (ArgO) isolated from the mushroom Amanita phalloides has been co-immobilized with peroxidase-like nanozymes on graphite electrodes to create highly sensitive and selective amperometric biosensors for arginine. These biosensors have demonstrated effectiveness in analyzing arginine content in pharmaceutical preparations, juices, and wine .

Arginine production:

  • Engineering ArgO-deficient strains could potentially increase intracellular arginine accumulation for industrial production

  • Conversely, controlled expression of ArgO could be used in bioprocessing to maintain optimal intracellular arginine levels

Canavanine resistance in agricultural applications:

  • Expression of ArgO in plants could potentially confer resistance to canavanine-producing competitor plants

  • Engineering probiotics with enhanced ArgO function could help livestock process canavanine-containing feeds

Protein production systems:

  • Controlling arginine levels via ArgO modulation could optimize the production of arginine-rich recombinant proteins

  • ArgO could be used as a regulatory component in synthetic biology circuits responding to arginine levels

What are unexplored aspects of ArgO regulation that warrant further research?

Several aspects of ArgO regulation remain unexplored and represent promising research directions:

Post-transcriptional regulation:

  • Potential regulation by small RNAs

  • Investigation of mRNA stability and translational efficiency

  • Possible riboswitch mechanisms responding to arginine

Additional transcriptional regulators:

  • Global regulators beyond ArgP and Lrp that might influence argO expression

  • Role of nucleoid-associated proteins in modulating argO chromatin structure

  • Potential regulation by two-component systems responding to environmental signals

Protein-level regulation:

  • Post-translational modifications affecting ArgO activity

  • Protein-protein interactions influencing transport function

  • Regulation through protein localization or clustering in the membrane

Integration with metabolic networks:

  • Connection to broader amino acid metabolic pathways

  • Role in stress responses beyond canavanine resistance

  • Integration with nitrogen metabolism regulation

Evolutionary aspects:

  • Comparative analysis of argO regulation across bacterial species

  • Evolutionary pressures that shaped the dual regulation by ArgP and Lrp

  • Correlation between argO regulatory mechanisms and ecological niches

How might ArgO research inform our understanding of membrane transport mechanisms?

Studies on ArgO can provide valuable insights into fundamental aspects of membrane transport:

Export mechanisms:

  • ArgO represents a model system for studying amino acid export, which is less well-characterized than import systems

  • Understanding the energy coupling and directional transport mechanisms could reveal general principles applicable to other exporters

Regulatory paradigms:

  • The competitive activation of ArgO by two regulators represents a rare regulatory mechanism that could be more widespread than currently appreciated

  • The integration of multiple signals (arginine, lysine, leucine) provides insights into how transporters respond to complex metabolic states

Structure-function relationships:

  • Identification of critical residues for substrate specificity and transport

  • Understanding how conformational changes drive transport

  • Elucidation of oligomerization states and their functional significance

Evolutionary adaptations:

  • The role of ArgO in canavanine resistance highlights how transport systems can evolve dual roles in normal metabolism and defense against natural toxins

  • Comparative analysis across species could reveal how different environmental pressures shape transporter function and regulation

Integration with cellular physiology:

  • ArgO's role in maintaining amino acid balance exemplifies how membrane transporters contribute to metabolic homeostasis

  • The connection between amino acid export and stress responses provides insights into bacterial adaptation mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.