Recombinant Aromatoleum aromaticum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aromatoleum aromaticum Cobalamin Synthase (cobS)

Recombinant Aromatoleum aromaticum cobalamin synthase (cobS) is a polytopic membrane protein critical for the final steps of vitamin B₁₂ (cobalamin) biosynthesis. Native to Aromatoleum aromaticum, a bacterium renowned for its aromatic compound degradation capabilities, cobS has been engineered for recombinant expression in Escherichia coli to enable controlled production and functional studies .

Critical Steps in Cobalamin Biosynthesis Involving cobS

  1. Adenosylcobinamide-GDP Formation:

    • CobU guanylylates adenosylcobinamide-phosphate (AdoCbi-P) to generate adenosylcobinamide-GDP (AdoCbi-GDP) .

  2. Nucleobase Activation:

    • CobT activates 5,6-dimethylbenzimidazole (DMB) via phosphoribosyl transfer to form α-ribazole-phosphate (α-RP) .

  3. Cobamide Synthesis:

    • CobS condenses AdoCbi-GDP and α-RP to form adenosylcobalamin-5'-phosphate (AdoCbl-P) .

  4. Dephosphorylation:

    • CobC removes the 5'-phosphate group from AdoCbl-P to yield active adenosylcobalamin .

Membrane Localization and Proton Motive Force (PMF) Disruption

CobS is embedded in the bacterial membrane, where its activity disrupts PMF. Overexpression in E. coli leads to:

  • Growth Arrest: Due to dissipation of membrane potential.

  • Mitigation Mechanisms: Co-expression of cobC (phosphatase) and pspA (phage shock protein A) stabilizes membrane integrity and restores growth .

Key Interactions and Dependencies

Partner ProteinRole
CobCDephosphorylates AdoCbl-P; stabilizes membrane potential with CobS .
PspAMitigates PMF disruption caused by cobS overexpression .
CobUGenerates AdoCbi-GDP for cobS-mediated condensation .
CobTActivates DMB to α-RP, a substrate for cobS .

Experimental Observations

  • Liposome Studies: CobS forms pore-like structures in membranes, enabling proton leakage .

  • Enzyme Activity: Recombinant cobS retains catalytic efficiency in vitro, enabling biochemical dissection of B₁₂ synthesis .

Industrial and Research Uses

  1. Vitamin B₁₂ Production:

    • Recombinant cobS enables scalable, controlled synthesis of adenosylcobalamin, a coenzyme for industrial enzymes (e.g., methylmalonyl-CoA mutase) .

  2. Membrane Protein Studies:

    • Model system for investigating polytopic membrane protein folding and proton channeling .

  3. Bioremediation:

    • Aromatoleum spp. utilize cobS in anaerobic degradation of aromatic pollutants, enhancing soil detoxification .

Table 2: Key Interactions in B₁₂ Biosynthesis

StepEnzymeSubstratesProducts
GuanylylationCobUAdoCbi-P, GTPAdoCbi-GDP, pyrophosphate
Nucleobase ActivationCobTDMB, NaMNα-RP, nicotinic acid
Cobamide SynthesisCobSAdoCbi-GDP, α-RPAdoCbl-P
DephosphorylationCobCAdoCbl-PAdoCbl, phosphate

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a reference for your own formulation.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
cobS; AZOSEA22720; ebA4005; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))
Target Names
cobS
Target Protein Sequence
MTTMRYQLELFFTALGFFTRLPVPAWVPWSPERLNHAARFFPLVGWVVGAIGAASYLAFV QLLPPALAVLLSMAVTIRATGAFHEDGWADACDGLGGGWDRLQVLTIMKDSRIGSYGTAG LVLMLLAKAAALVELAAHGNLQVALALLAAHPLSRLASTSLIHTMQYVREDESAKSKPLA RRLSATELVVAAVFGLAPLALLAPAEALAALTATAAATLWAARVFARRLGGYTGDCLGAA QQGSELACYLGILAAWNFI
Uniprot No.

Target Background

Function

This protein catalyzes the joining of adenosylcobinamide-GDP and α-ribazole to produce adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links

KEGG: eba:ebA4005

STRING: 76114.ebA4005

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aromatoleum aromaticum and why is it significant as a research organism?

Aromatoleum aromaticum EbN1 is a versatile aquatic betaproteobacterium that anaerobically degrades 24 different monoaromatic compounds, including petroleum hydrocarbons, phenolic solvents, and 3-phenylpropanoids . It serves as an excellent model organism for studying anaerobic degradation of aromatic compounds. With few exceptions, these aromatic substrates are channeled via specific reaction sequences into the central anaerobic benzoyl coenzyme A (benzoyl-CoA) pathway . The availability of its complete genome sequence and comprehensive proteomic data on substrate-dependent regulation of its catabolic network qualify strain EbN1 as a promising model system for investigating the influence of growth rates on anaerobic metabolism of aromatic compounds .

What is the function of cobalamin synthase (CobS) in bacterial metabolism?

Cobalamin synthase (CobS) catalyzes a critical step in the nucleotide loop assembly pathway of adenosylcobalamin (vitamin B12) biosynthesis. Based on studies in Salmonella typhimurium, CobS specifically catalyzes the attachment of the lower ligand base to adenosylcobinamide-GDP to form adenosylcobalamin-5′-phosphate . This enzyme activity was confirmed through in vitro experiments where incubation of adenosylcobinamide-GDP and α-ribazole-5′-phosphate (the product of the CobT reaction) with CobS resulted in the synthesis of adenosylcobalamin-5′-phosphate . This reaction represents one of the final steps in the complex biosynthesis pathway of cobalamin.

How can Aromatoleum aromaticum be cultivated for experimental studies?

Aromatoleum aromaticum can be cultivated under anoxic (nitrate-amended) conditions. For controlled growth studies, benzoate-limited chemostats can be established to study the physiological and proteomic adaptation of the strain at different steady-state growth rates . Specifically, the organism has been successfully studied at low (μlow = 0.036 h−1), medium (μmed = 0.108 h−1), and high (μhigh = 0.180 h−1) growth rates . For identification and verification purposes, whole-cell hybridization can be performed using specific oligonucleotide probes like EbN825, which targets the 16S rRNA of strain EbN1 .

What metabolic pathways involve cobalamin in Aromatoleum aromaticum?

While the provided search results don't specifically detail cobalamin-dependent pathways in A. aromaticum, cobalamin (vitamin B12) generally serves as an essential cofactor for various enzymes involved in methylation reactions, isomerization reactions, and rearrangements. In bacteria capable of degrading aromatic compounds, cobalamin-dependent enzymes often participate in key transformations within degradation pathways. Given A. aromaticum's metabolic versatility in degrading aromatic compounds, cobalamin likely plays important roles in its catabolic network, particularly under anaerobic conditions.

How does the expression of CobS vary under different growth conditions in Aromatoleum aromaticum?

Based on the proteomic studies of A. aromaticum grown at different rates, growth rate significantly impacts protein expression patterns. The most comprehensive proteomic changes were observed between slow (μlow) and fast (μhigh) growth conditions . At slow growth rates, A. aromaticum showed increased abundances of diverse catabolic proteins and components of uptake systems even in the absence of their respective substrates, suggesting preparation for future metabolic needs . While not specifically mentioned for CobS, this pattern suggests that cobalamin biosynthesis enzymes might similarly be regulated in response to growth rate, potentially showing higher expression during slow growth as part of a general strategy to enhance metabolic versatility under resource-limited conditions.

What structural and functional features distinguish Aromatoleum aromaticum CobS from homologs in other bacteria?

  • Sequence homology and conserved domains

  • Substrate specificity differences

  • Kinetic parameters under various conditions

  • Structural features through homology modeling

  • Potential regulatory differences in gene expression

The S. typhimurium CobS has been demonstrated to catalyze the synthesis of adenosylcobalamin-5′-phosphate from adenosylcobinamide-GDP and α-ribazole-5′-phosphate . Comparative studies could reveal adaptations in the A. aromaticum enzyme related to its ecological niche.

How can CobS activity be measured in complex bacterial systems?

Based on methodologies developed for S. typhimurium CobS, several approaches could be adapted:

  • Radioactive assays: Using [14C]α-ribazole-5′-P (0.3 nmol) mixed with unlabeled α-ribazole-5′-P (0.9 nmol), reactions can be quantified after stopping with KCN and heating .

  • HPLC separation and identification: Products can be identified after isolation by HPLC, using UV-visible spectroscopy and mass spectrometry for confirmation .

  • Bioassays: Functional cobalamin production can be assessed using cobalamin auxotrophs, providing a biological readout of enzyme activity .

  • In vitro reconstitution: Complete pathway reconstitution can be achieved by including all necessary enzymes (e.g., CobU, CobS, CobT, and CobC in S. typhimurium) along with substrates adenosylcobinamide, 5,6-dimethylbenzimidazole, nicotinate mononucleotide, and GTP .

How does the responsiveness of Aromatoleum aromaticum to lignin-derived compounds affect cobalamin biosynthesis?

A. aromaticum EbN1 demonstrates remarkable responsiveness to lignin-derived compounds, particularly 3-phenylpropanoids . Time-resolved, targeted transcript analyses via quantitative reverse transcription-PCR of selected 3-phenylpropanoid genes revealed response thresholds in the nanomolar range, indicating high sensitivity to these compounds . This responsiveness suggests sophisticated regulatory mechanisms that likely extend to other metabolic pathways, potentially including cobalamin biosynthesis. Given that cobalamin is an essential cofactor for various metabolic processes, its synthesis might be coordinated with the expression of catabolic pathways for aromatic compounds. Future research could investigate whether specific lignin-derived compounds act as signals that modulate cobS expression.

What expression systems are most suitable for producing recombinant Aromatoleum aromaticum CobS?

Based on general protein expression principles and considering the characteristics of A. aromaticum:

  • Host selection: E. coli BL21(DE3) or its derivatives would likely be suitable hosts, though adaptation for membrane-associated proteins might be necessary.

  • Vector design: Vectors with adjustable expression control, such as pET systems with T7 promoters, would allow optimization of expression levels.

  • Fusion tags: Affinity tags like His6 would facilitate purification, while solubility enhancers like MBP might improve protein folding.

  • Expression conditions: Lower temperatures (15-25°C) and reduced inducer concentrations might improve soluble protein yields.

  • Codon optimization: Adapting the cobS gene sequence to the expression host's codon preference could enhance expression efficiency.

The methodology used for whole-cell hybridization of A. aromaticum (46°C for 3 h in hybridization buffer containing 0.9 M NaCl, 20 mM Tris-HCl, 0.01% SDS, and 30% formamide) indicates conditions where the organism's proteins remain stable , potentially informing recombinant protein handling.

What purification strategies are most effective for isolating functional recombinant CobS?

Efficient purification of recombinant CobS would likely involve:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged proteins or specialized affinity resins for other tags.

  • Intermediate purification: Ion exchange chromatography based on the predicted isoelectric point of CobS.

  • Polishing: Size exclusion chromatography to remove aggregates and ensure homogeneity.

  • Buffer optimization: Testing various buffer compositions to maintain enzyme stability and activity, potentially including:

    • pH range (typically 7.0-8.5)

    • Salt concentration (100-500 mM)

    • Glycerol (10-20%)

    • Reducing agents (DTT or β-mercaptoethanol)

    • Metal ions if required for stability

  • Activity verification: Developing appropriate activity assays based on known CobS function to confirm that the purified protein retains catalytic activity.

How can genetic engineering approaches be applied to study CobS function in Aromatoleum aromaticum?

Several genetic approaches could be employed:

  • Gene knockout or knockdown: Creating cobS deletion mutants or using RNA interference to assess the phenotypic consequences of reduced CobS activity.

  • Complementation studies: Reintroducing wild-type or mutated cobS genes into knockout strains to confirm function and study structure-function relationships.

  • Reporter fusions: Creating transcriptional or translational fusions to study cobS regulation under various conditions.

  • Site-directed mutagenesis: Introducing specific mutations to identify catalytically important residues.

  • Heterologous expression: Expressing A. aromaticum cobS in other bacteria to study its function in different genetic backgrounds.

The specificity of oligonucleotide probes like EbN825 for A. aromaticum demonstrates the feasibility of sequence-specific approaches for genetic manipulation of this organism.

What factors should be considered when designing assays for CobS activity?

Based on the established assays for Salmonella CobS, key considerations include:

ParameterConsiderationsRecommended Approach
Substrate preparationAdenosylcobinamide-GDP and α-ribazole-5′-P are complex moleculesEither biochemical synthesis or commercial sources with verified purity
Reaction conditionspH, temperature, and ionic strength affect enzyme activityInitial testing with pH 7.5-8.0, 30-37°C, 100-200 mM NaCl
Detection methodProduct detection requires sensitive methodsHPLC with UV detection, mass spectrometry, or radioactive assays
Reaction terminationComplete inactivation needed for accurate measurementsKCN treatment (20 mM) followed by heating (80°C for 10 min)
ControlsEssential for result validationInclude no-enzyme controls and standards for product quantification

Reaction components should initially follow established protocols (e.g., using 50 nmol of adenosylcobinamide-GDP and α-ribazole-5′-P in a 20 μl reaction volume) .

How can researchers integrate multi-omics approaches to understand CobS function in the context of Aromatoleum aromaticum metabolism?

A comprehensive multi-omics approach would include:

  • Genomics: Identifying the cobS gene and related cobalamin biosynthesis genes in the A. aromaticum genome.

  • Transcriptomics: Using RNA-seq or qRT-PCR to measure expression changes of cobS under different growth conditions, similar to the targeted transcript analyses performed for 3-phenylpropanoid genes .

  • Proteomics: Quantifying CobS protein levels and potential post-translational modifications under various conditions, drawing on established protocols for A. aromaticum proteome analysis .

  • Metabolomics: Measuring levels of cobalamin and pathway intermediates to assess flux through the biosynthetic pathway.

  • Fluxomics: Using isotope-labeled precursors to track metabolic flux through the cobalamin pathway.

Integration of these datasets could reveal how CobS activity is coordinated with other metabolic processes, particularly those involved in aromatic compound degradation.

What challenges might researchers encounter when studying the in vivo function of CobS in Aromatoleum aromaticum?

Several challenges are likely to arise:

  • Growth conditions: Maintaining consistent anaerobic conditions for A. aromaticum growth, particularly when using nitrate as an electron acceptor .

  • Complex metabolism: Distinguishing the specific effects of CobS deficiency from broader metabolic perturbations, given A. aromaticum's complex catabolic network .

  • Genetic manipulation: Developing efficient transformation protocols for A. aromaticum, which may require optimization compared to model organisms.

  • Phenotypic assessment: Identifying suitable phenotypic readouts for CobS function, as cobalamin deficiency could affect multiple metabolic pathways.

  • Physiological adaptation: Accounting for the organism's adaptive responses to different growth conditions, which include comprehensive proteomic changes .

How might engineered variants of Aromatoleum aromaticum CobS contribute to bioremediation technologies?

Engineered CobS variants could potentially enhance bioremediation applications through:

  • Improved cobalamin production: Enhancing the efficiency of cobalamin biosynthesis could boost the activity of cobalamin-dependent enzymes involved in degrading recalcitrant compounds.

  • Modified substrate specificity: Engineered CobS variants might produce novel cobalamin analogs with enhanced properties for specific degradation pathways.

  • Stress resistance: Variants with increased stability under environmental stressors could improve the resilience of bioremediation systems.

  • Integration with degradation pathways: Coordinating cobS expression with genes involved in degrading specific pollutants could optimize remediation efficiency.

Given A. aromaticum's natural capacity to degrade various aromatic compounds , enhancing its cobalamin biosynthesis capabilities could further expand its bioremediation potential.

What is the potential for using recombinant CobS in the synthesis of novel cobalamin derivatives?

The in vitro synthesis system established for Salmonella CobS suggests a promising approach for using recombinant A. aromaticum CobS to produce novel cobalamin derivatives:

  • Alternative base incorporation: Providing CobS with analogs of 5,6-dimethylbenzimidazole could yield cobalamin derivatives with modified lower ligands.

  • Chemoenzymatic synthesis: Combining chemical synthesis steps with enzymatic reactions to produce structurally diverse cobalamins.

  • Immobilized enzyme systems: Developing immobilized CobS biocatalysts for continuous production of cobalamin derivatives.

  • Coupled enzyme reactions: Creating multi-enzyme systems that produce complete cobalamin derivatives from simpler precursors.

Such novel cobalamin derivatives could have applications in studying B12-dependent enzymes, as probes for metabolic pathways, or potentially as therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.