Recombinant Aromatoleum aromaticum Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Disulfide Bond Formation

DsbB operates within the DsbA/DsbB oxidative folding system:

  1. Oxidation Cycle: DsbA donates disulfide bonds to substrate proteins, becoming reduced. DsbB reoxidizes DsbA via quinone-coupled electron transfer .

  2. Membrane Topology: Anchored in the inner membrane, DsbB transfers electrons from DsbA to ubiquinone, maintaining DsbA’s oxidized state .

  3. Quality Control: Prevents misfolding by ensuring efficient disulfide bond formation, critical for virulence factors and membrane proteins .

Figure 1: DsbA/DsbB redox cycle in A. aromaticum periplasm .

Research Applications and Implications

  • Antibiotic Development: Targeting DsbB disrupts disulfide bond formation in pathogens, reducing virulence .

  • Bioremediation: A. aromaticum’s aromatic degradation pathways depend on properly folded enzymes, making DsbB crucial for metabolic studies .

  • Structural Biology: Recombinant DsbB enables crystallographic studies to elucidate electron transfer mechanisms .

Comparative Analysis with Homologs

Table 3: DsbB Across Species

SpeciesRedox PartnerActive Site MotifKey Function
A. aromaticumDsbACPHCOxidative folding in aromatic metabolism
E. coliDsbACPHCVirulence factor assembly
Xanthomonas oryzaeDsbACPHCPlant pathogenicity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
dsbB; AZOSEA21980; ebA3876; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))
Target Names
dsbB
Target Protein Sequence
MQSFAFSTRALFLGLFAVCAGLLGFGLYLQHAVGLEPCPMCIMQRYAFVAIALTALVAGL HGPGRRGTRAYAAVILLLALAGGGVALRQTWMQLYPPEFAECGPDLEFMLGSFPLADALP MIFQGAGDCSKVDWAFLGLSIANWSLVCLTLVAVFAIMMIARKRGG
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: eba:ebA3876

STRING: 76114.ebA3876

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aromatoleum aromaticum and why is it significant in research?

Aromatoleum aromaticum is a betaproteobacterium belonging to the genus Aromatoleum, which comprises facultative denitrifiers specialized in the anaerobic degradation of recalcitrant organic compounds, including aromatics and terpenoids. The species has gained significant attention in research due to its versatile metabolic capabilities and genome plasticity. Aromatoleum aromaticum strain EbN1 (previously classified as Azoarcus sp. strain EbN1) has been fully genome sequenced, making it a valuable model organism for studying anaerobic degradation pathways . The organism's ability to degrade environmentally challenging compounds makes it relevant for both basic research and potential biotechnological applications.

What is the disulfide bond formation protein B (dsbB) and what role does it play?

Disulfide bond formation protein B (dsbB) in Aromatoleum aromaticum is a membrane protein involved in the formation of disulfide bridges in proteins. The protein consists of 166 amino acids and functions as a disulfide oxidoreductase . DsbB is part of the bacterial disulfide bond formation pathway, which is crucial for the correct folding and stability of many proteins, particularly those secreted or located in the periplasm. In this pathway, DsbB reoxidizes DsbA (another key protein in this system), allowing DsbA to continue catalyzing disulfide bond formation in substrate proteins. This molecular mechanism is essential for bacterial protein quality control and proper functioning of many cellular processes.

What are the storage and handling considerations for recombinant dsbB protein?

When working with Recombinant Aromatoleum aromaticum dsbB protein, proper storage and handling are critical to maintain functionality. The protein should be stored at -20°C for general storage, with -80°C recommended for extended preservation . The storage buffer typically consists of a Tris-based solution with 50% glycerol, optimized specifically for this protein. Repeated freeze-thaw cycles should be avoided as they can compromise protein stability and activity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week . Always follow manufacturer-specific guidelines, as formulation details may vary between suppliers.

How does the structure-function relationship of dsbB in Aromatoleum aromaticum compare to that in other bacterial species?

The structure-function relationship of dsbB in Aromatoleum aromaticum shares fundamental similarities with other bacterial species while displaying species-specific adaptations. The protein contains the characteristic CXXC motifs essential for disulfide exchange reactions, as evidenced by the presence of cysteine residues in its sequence (notably in the "PCPMC" sequence region) . Unlike better-studied dsbB proteins from model organisms like E. coli, the Aromatoleum aromaticum variant may possess adaptations related to the organism's unique ecological niche as an anaerobic degrader of aromatic compounds.

The transmembrane topology appears to follow the typical arrangement seen in other bacterial dsbB proteins, with four transmembrane segments and two periplasmic loops containing the catalytically active cysteine residues. Comparative analyses with dsbB proteins from related species such as Azoarcus sp. and Dechloromonas aromatica would be particularly valuable, as these organisms share similar ecological niches and metabolic capabilities . Examining these structural similarities and differences could provide insights into potential functional adaptations related to the organism's lifestyle.

What methodological approaches are most effective for expressing and purifying functional recombinant dsbB from Aromatoleum aromaticum?

Expression and purification of functional recombinant dsbB from Aromatoleum aromaticum presents several challenges due to its nature as a membrane protein with multiple transmembrane domains. Based on general approaches for similar proteins, the following methodological considerations are recommended:

Expression Systems:

  • E. coli-based expression systems (BL21(DE3), C41(DE3), or C43(DE3)) optimized for membrane proteins

  • Expression vectors containing mild promoters (like pBAD) to prevent toxicity

  • Fusion tags that enhance solubility and facilitate purification (MBP, SUMO, or His6)

Optimization Parameters:

  • Lower induction temperatures (16-20°C)

  • Reduced inducer concentrations

  • Extended expression times (overnight)

  • Addition of membrane-stabilizing agents

Purification Strategy:

  • Membrane fraction isolation via differential centrifugation

  • Solubilization using mild detergents (DDM, LMNG, or Digitonin)

  • Affinity chromatography utilizing the fusion tag

  • Size exclusion chromatography for final polishing

Functional Verification:

  • Enzymatic activity assays measuring disulfide oxidoreductase function

  • Circular dichroism to assess secondary structure integrity

  • Thermal shift assays to evaluate protein stability

These methodological approaches should be fine-tuned based on the specific experimental objectives and available resources.

How can researchers effectively investigate the interaction between dsbB and its physiological partners in Aromatoleum aromaticum?

To investigate the interaction between dsbB and its physiological partners in Aromatoleum aromaticum, researchers should employ a multi-faceted approach:

Identification of Interaction Partners:

  • Co-immunoprecipitation coupled with mass spectrometry

  • Bacterial two-hybrid screening

  • Proximity-based labeling approaches (BioID or APEX)

  • Cross-linking mass spectrometry to capture transient interactions

Characterization of Interactions:

  • Surface plasmon resonance or isothermal titration calorimetry for binding kinetics

  • Fluorescence resonance energy transfer (FRET) for in vivo interaction dynamics

  • Nuclear magnetic resonance (NMR) spectroscopy for mapping interaction interfaces

  • Site-directed mutagenesis of predicted interface residues followed by functional assays

Functional Consequences:

  • In vitro reconstitution assays with purified components

  • Monitoring redox states of interacting proteins using modified thiol-trapping techniques

  • Construction of knockout/complementation strains for in vivo validation

  • Quantitative proteomic analysis of disulfide proteome alterations

These approaches collectively provide a comprehensive understanding of dsbB's interaction network and functional significance within the cellular context of Aromatoleum aromaticum.

What are the critical factors to consider when designing experiments to study dsbB function in anaerobic conditions?

When investigating dsbB function in anaerobic conditions relevant to Aromatoleum aromaticum's natural environment, several critical factors must be carefully controlled:

Oxygen Exclusion Techniques:

  • Use of anaerobic chambers with controlled gas composition

  • Implementation of oxygen-scavenging enzyme systems

  • Proper degassing of all media and buffers

  • Oxygen-impermeable containers and seals

Redox Environment Control:

  • Precise monitoring and adjustment of redox potential using electrodes

  • Addition of appropriate redox buffers

  • Inclusion of redox indicators for visual verification

  • Regular monitoring to ensure stable anaerobic conditions

Experimental Adaptations:

  • Modified activity assays compatible with anaerobic conditions

  • Techniques for rapid sampling that minimize oxygen exposure

  • Specialized equipment for anaerobic protein handling

Controls and Validation:

  • Parallel aerobic controls to establish baseline comparisons

  • Positive controls using known anaerobically active proteins

  • Inactivated enzyme controls to account for non-enzymatic reactions

  • Redox state verification of the protein before and after experiments

These experimental design considerations ensure that the functional characterization of dsbB accurately reflects its behavior under the physiologically relevant anaerobic conditions experienced by Aromatoleum aromaticum.

What are the recommended approaches for analyzing the impact of dsbB on protein folding in Aromatoleum aromaticum?

To analyze the impact of dsbB on protein folding in Aromatoleum aromaticum, researchers should consider the following comprehensive approaches:

Genetic Manipulation Strategies:

  • Construction of dsbB knockout strains using homologous recombination

  • Development of conditional expression systems for controlled depletion

  • Site-directed mutagenesis of catalytic cysteines (e.g., within the PCPMC motif)

  • Complementation with wild-type or mutant variants

Proteome-Wide Analysis:

  • Comparative proteomics of wild-type vs. dsbB mutant strains

  • Redox proteomics to identify proteins with altered disulfide status

  • Pulse-chase experiments combined with immunoprecipitation to track folding kinetics

  • Two-dimensional gel electrophoresis under non-reducing and reducing conditions

Model Substrate Analysis:

  • Selection of representative periplasmic proteins with known disulfide bonds

  • Enzyme activity assays as proxies for proper folding

  • Sensitivity to protease digestion as indicator of structural integrity

  • Direct assessment of disulfide bond formation using mass spectrometry

Physiological Impact Assessment:

  • Growth phenotyping under various stress conditions

  • Biofilm formation capacity

  • Motility assays

  • Sensitivity to redox-active compounds

The comprehensive dataset generated through these approaches would provide a detailed understanding of dsbB's role in protein folding within the specific cellular context of Aromatoleum aromaticum.

How should researchers interpret conflicting results between in vitro and in vivo studies of dsbB function?

When faced with conflicting results between in vitro and in vivo studies of dsbB function in Aromatoleum aromaticum, researchers should adopt a systematic analytical framework:

Sources of Discrepancies:

  • Environmental Differences: In vitro systems lack the complex redox environment and molecular crowding present in cells. Aromatoleum aromaticum's native anaerobic environment is particularly challenging to replicate in vitro.

  • Protein Partner Availability: The absence of physiological partners in purified systems may alter dsbB behavior substantially.

  • Post-translational Modifications: Modifications present in vivo may be absent in recombinant proteins.

  • Membrane Composition Effects: Different lipid environments between in vitro systems and native membranes can significantly impact membrane protein function.

Resolution Strategies:

  • Bridging Experiments: Design intermediate complexity experiments using membrane vesicles or spheroplasts that retain some cellular complexity.

  • Reconstitution Studies: Systematically add cellular components to in vitro systems to identify missing factors.

  • In-Cell Validation: Develop methods to directly measure dsbB activity within living Aromatoleum aromaticum cells.

  • Computational Modeling: Integrate data from both approaches to build predictive models that account for discrepancies.

Interpretation Framework:

  • Evaluate which system better represents the biological question being addressed

  • Consider the specific limitations of each experimental approach

  • Prioritize results from systems that most closely mimic physiological conditions

  • Explore whether discrepancies themselves reveal important biological insights

This analytical approach transforms conflicting results into valuable research opportunities that deepen understanding of context-dependent dsbB function.

What statistical approaches are most appropriate for analyzing the effects of environmental conditions on dsbB activity?

When analyzing the effects of environmental conditions on dsbB activity in Aromatoleum aromaticum, researchers should employ appropriate statistical approaches based on experimental design complexity:

For Single Variable Experiments:

  • T-tests for comparing dsbB activity between two specific conditions

  • ANOVA followed by post-hoc tests (Tukey's HSD or Bonferroni) for multiple condition comparisons

  • Regression analysis for examining dose-dependent responses to environmental factors

For Multifactorial Experiments:

  • Factorial ANOVA to assess main effects and interactions between variables

  • Response surface methodology to optimize conditions for dsbB activity

  • Principal component analysis to identify key factors driving variation in complex datasets

For Time-Series Data:

  • Repeated measures ANOVA for comparing activity trajectories under different conditions

  • Time-series regression models to identify temporal patterns in dsbB response

  • Change-point analysis to detect critical thresholds in environmental parameters

Advanced Approaches:

  • Hierarchical Bayesian models that incorporate prior knowledge about dsbB biochemistry

  • Machine learning algorithms for identifying complex patterns in multidimensional datasets

  • Network analysis to relate dsbB activity to broader cellular outcomes

Example Data Presentation Table:

Environmental ParameterParameter RangeStatistical MethodEffect on dsbB ActivitySignificance (p-value)
pH6.0-8.0One-way ANOVAOptimal at pH 7.2p<0.001
Temperature20-40°CRegression analysisLinear increase to 30°C, then decreasep<0.01
Redox potential-300 to +100 mVFactorial ANOVABimodal response, peaks at -150 and +50 mVp<0.05
Ionic strength50-300 mM NaClt-testDecreased activity above 200 mMp<0.01

This structured statistical approach ensures robust analysis and interpretation of environmental effects on dsbB activity.

How can studying Aromatoleum aromaticum dsbB contribute to understanding anaerobic degradation pathways?

Studying Aromatoleum aromaticum dsbB offers unique insights into anaerobic degradation pathways through several interconnected mechanisms:

Protein Quality Control in Specialized Metabolic Pathways:
The disulfide bond formation system, including dsbB, ensures proper folding of enzymes involved in anaerobic degradation pathways. Aromatoleum aromaticum is specialized in degrading recalcitrant organic compounds, including aromatics and terpenoids, under anaerobic conditions . The enzymes in these pathways often contain disulfide bonds that are critical for their structure and function. By maintaining the proper folding of these enzymes, dsbB indirectly supports the organism's distinctive metabolic capabilities.

Adaptation to Changing Redox Environments:
Aromatoleum aromaticum transitions between aerobic and anaerobic lifestyles, requiring sophisticated redox management systems. The dsbB/DsbA system likely plays a crucial role in helping the organism adapt to these changing conditions by ensuring appropriate protein folding across different redox environments. This adaptability is particularly important for an organism that uses various electron acceptors during anaerobic respiration.

Evolutionary Insights:
Comparative analysis of dsbB across Aromatoleum species with different degradative capabilities (Ar. aromaticum EbN1T, Ar. petrolei ToN1T, and Ar. bremense PbN1T) could reveal how disulfide bond formation machinery has evolved alongside specialized metabolic pathways . The genomic context of dsbB may provide clues about its co-evolution with anaerobic degradation pathways, especially given the known genomic plasticity of Aromatoleum species and evidence that horizontal gene transfer has shaped their metabolic capabilities .

Future Research Directions:

  • Investigation of dsbB regulation in response to different aromatic substrates

  • Proteomic identification of dsbB-dependent proteins in anaerobic degradation pathways

  • Comparative analysis of disulfide bond formation systems across Aromatoleum species with different substrate preferences

What are the most promising future research directions for Aromatoleum aromaticum dsbB?

Future research on Aromatoleum aromaticum dsbB presents several promising directions that could yield significant scientific insights:

Structural Biology Approaches:

  • Determination of high-resolution crystal or cryo-EM structures of Aromatoleum aromaticum dsbB

  • Comparative structural analysis with dsbB from aerobic organisms to identify adaptations for functioning under anaerobic conditions

  • Structure-guided engineering to enhance stability or modify substrate specificity

Systems Biology Integration:

  • Network analysis integrating transcriptomic, proteomic, and metabolomic data to position dsbB within the cell's global response to environmental changes

  • Development of computational models predicting dsbB-dependent protein folding under various environmental conditions

  • Investigation of regulatory networks controlling dsbB expression during substrate shifts

Biotechnological Applications:

  • Exploration of dsbB as a tool for improving expression of disulfide-bonded proteins under anaerobic conditions

  • Development of biosensors utilizing dsbB-dependent reporters to monitor anaerobic processes

  • Engineering of Aromatoleum aromaticum strains with enhanced dsbB function for bioremediation applications

Ecological Significance:

  • Examination of dsbB function in environmental samples to understand its role in microbial communities

  • Investigation of dsbB as a potential marker for monitoring anaerobic degradation capabilities in contaminated environments

  • Study of horizontal gene transfer patterns involving dsbB and associated disulfide bond formation components

These research directions collectively advance both fundamental understanding of protein quality control in specialized anaerobic bacteria and applied aspects that could benefit biotechnology and environmental remediation efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.