Recombinant Aromatoleum aromaticum Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Functional Overview

The recombinant Aromatoleum aromaticum MsbA protein is a full-length ATP-binding cassette (ABC) transporter involved in lipid A export and membrane integrity in gram-negative bacteria. It belongs to the multidrug resistance (MDR) ABC transporter family, sharing structural and functional homology with MsbA from Escherichia coli and Salmonella typhimurium. Its primary role includes flipping lipid A—a core component of lipopolysaccharide (LPS)—from the cytoplasmic to the periplasmic leaflet of the inner membrane, enabling LPS assembly and outer membrane stability .

Key Functional Properties

PropertyDescription
Gene NamemsbA
SynonymsLipid A export ATP-binding/permease protein MsbA
UniProt IDQ31FG2
FunctionATP-dependent lipid flippase for lipid A and phospholipids
EssentialityCritical for bacterial viability in gram-negative pathogens
Domain StructureN-terminal transmembrane domains (TMDs) + C-terminal nucleotide-binding domains (NBDs)

Lipid A Transport and ATP Hydrolysis

MsbA operates via an alternating-access mechanism, coupling ATP hydrolysis to lipid translocation. Key findings include:

  • Lipid Activation: Hexaacylated lipid A (e.g., Kdo₂-lipid A) stimulates ATPase activity 4–5-fold, with a Km of ~379 μM and Vmax of 154 nmol/min/mg .

  • Conformational Flexibility: Structural studies reveal large-scale movements between inward-facing (substrate-binding) and outward-facing (substrate-release) states, critical for transport .

Role in Antibiotic Resistance and Membrane Stability

MsbA’s polyspecificity allows it to efflux amphipathic drugs and antimicrobial agents, contributing to multidrug resistance. In Aromatoleum aromaticum, this may enhance survival in environments with toxic metabolites .

Experimental Utility

The recombinant protein enables:

  • ELISA Development: Detection of MsbA-specific antibodies for studying bacterial pathogenesis .

  • Lipid Flippase Assays: Reconstitution into proteoliposomes to measure ATP-dependent phospholipid translocation .

Comparative Analysis with Other MsbA Homologs

FeatureAromatoleum aromaticum MsbAE. coli MsbASalmonella typhimurium MsbA
Key SubstrateLipid A, phospholipidsLipid A, LPS precursorsLipid A, glycerophospholipids
ATPase ActivityNot explicitly reported154 nmol/min/mg (with lipid A)37 nmol/min/mg (basal activity)
Structural DataLimitedX-ray structures (2.8 Å)Cryo-EM conformations
Pathogenic RelevanceHypothesized (denitrifying bacteria)Essential for LPS biogenesisCritical for outer membrane integrity

Challenges and Future Directions

  1. Structural Gaps: No high-resolution structures of Aromatoleum aromaticum MsbA are publicly available, unlike E. coli and Salmonella homologs .

  2. Functional Specificity: Studies are needed to confirm substrate preferences and ATPase kinetics in Aromatoleum aromaticum.

  3. Biotechnological Potential: Exploring MsbA as a target for novel antibiotics or biocatalysts in lipid metabolism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
msbA; AZOSEA22620; ebA3992; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))
Target Names
msbA
Target Protein Sequence
MHRSDAAPASSIRIYFRLLSYVRPYVGLFAVSILGYVIFASSQPMLAGVLKYFVDGLTHP DAALVTGVPLLDGMELMHGVPLMIVLIAAWQGLGGYLGNYFLARVSLGLVHDLRQTLFDS LLRLPNTYFDQHSSGHLISRITFNVTMVTGAATDAIKIVIREGLTVVFLFAYLLWMNWRL TLVMVAILPLISLMVRNASGKFRKQSRKIQVAMGDVTHVASETIQGYRVVRSFGGEHYER ERFRAASEDNTRKQLKMVKTSAVYTPTLQLVTYSAMAVVLFLVLRLRGEASVGDLVAYIT AAGLLPKPIRQLSEVSSTIQRGVAGAESIFEQLDDKPEVDHGRIERERVSGRIEVRDLSF RYPGSDREVLDSVSFTVEPGQMIALVGRSGSGKSTLANLIPRFYHHDRGQILIDGVDVED YTLKNLRRHIALVTQQVTLFNDTVANNIAYGDLAGLPRAAVEAAAEAGYAKEFIDRLPQG FDTLIGENGVTLSGGQRQRLAIARALLKNAPILILDEATSALDTESERHIQAALHRVMQA RTTLVIAHRLSTIEQADVIMVMDHGRIVERGSHAELLAAGGHYARLHAMQFREEPAVAEG R
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: eba:ebA3992

STRING: 76114.ebA3992

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Aromatoleum aromaticum MsbA protein and what is its function?

MsbA in Aromatoleum aromaticum functions as an ABC (ATP-binding cassette) transporter that acts as a lipid A flippase. This essential membrane protein is responsible for translocating lipopolysaccharide precursors from the inner to the outer leaflet of the bacterial inner membrane, a critical step in outer membrane biogenesis of Gram-negative bacteria. The recombinant version is produced with a His-tag to facilitate purification and experimental manipulation.

The full-length protein consists of 601 amino acids with characteristic transmembrane domains and nucleotide-binding domains that enable ATP-dependent transport. The protein contains multiple membrane-spanning regions that form the translocation pathway for lipid substrates .

How is Recombinant Aromatoleum aromaticum MsbA protein produced?

Recombinant Aromatoleum aromaticum MsbA protein is expressed in E. coli expression systems using the full-length sequence (amino acids 1-601) fused to an N-terminal His-tag . The expression system is designed to produce functional membrane proteins while allowing for efficient purification.

The production process typically involves:

  • Cloning the msbA gene from Aromatoleum aromaticum into an expression vector

  • Transformation into an E. coli expression strain

  • Induction of protein expression under optimized conditions

  • Cell disruption and membrane isolation

  • Detergent solubilization of membrane proteins

  • Affinity purification using the His-tag

  • Lyophilization to produce the final powder form

What are the optimal storage conditions for Recombinant Aromatoleum aromaticum MsbA protein?

The proper storage of Recombinant Aromatoleum aromaticum MsbA protein is critical for maintaining its structural integrity and functional activity. Based on manufacturer recommendations, the optimal storage conditions are:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Physical formLyophilized powder
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
StabilizationAdd 5-50% glycerol (final concentration)
Important noteAvoid repeated freeze-thaw cycles

Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity . For optimal results, it is advisable to aliquot the reconstituted protein for single use and store at -80°C for extended preservation.

What are the key structural features of MsbA from Aromatoleum aromaticum?

The Recombinant Aromatoleum aromaticum MsbA protein exhibits characteristic structural features of ABC transporters. Analysis of its 601-amino acid sequence reveals:

  • Transmembrane domains (TMDs): Multiple membrane-spanning α-helices that form the substrate translocation pathway

  • Nucleotide-binding domains (NBDs): Contain Walker A and Walker B motifs for ATP binding and hydrolysis

  • Coupling helices: Connect the TMDs to NBDs, allowing conformational changes to be transmitted between domains

  • Substrate-binding pocket: Formed by the TMDs and involved in recognizing lipid A and potentially other substrates

The amino acid sequence (MHRSDAAPASSIRIYFRLLSYVRPYVGLFAVSILGYVIFASSQPMLAGVLKYFVDGLTHPDAALVTGVPLLDGMELMHGVPLMIVLIAAWQGLGGYLGNYFLARVSLGLVHDLRQTLFDSLLRLPNTYFDQHSSGHLISRITFNVTMVTGAATDAIKIVIREGLTVVFLFAYLLWMNWRLTLVMVAILPLISLMVRNASGKFRKQSRKIQVAMGDVTHVASETIQGYRVVRSFGGEHYERERFRAASEDNTRKQLKMVKTSAVYTPTLQLVTYSAMAVVLFLVLRLRGEASVGDLVAYITAAGLLPKPIRQLSEVSSTIQRGVAGAESIFEQLDDKPEVDHGRIERERVSGRIEVRDLSFRYPGSDREVLDSVSFTVEPGQMIALVGRSGSGKSTLANLIPRFYHHDRGQILIDGVDVEDYTLKNLRRHIALVTQQVTLFNDTVANNIAYGDLAGLPRAAVEAAAEAGYAKEFIDRLPQGFDTLIGENGVTLSGGQRQRLAIARALLKNAPILILDEATSALDTESERHIQAALHRVMQARTTLVIAHRLSTIEQADVIMVMDHGRIVERGSHAELLAAGGHYARLHAMQFREEPAVAEGR) reveals the presence of these structural elements essential for its function .

How does MsbA from Aromatoleum aromaticum compare to MsbA homologs from other bacterial species?

Comparing MsbA from Aromatoleum aromaticum with homologs from other bacterial species reveals important evolutionary relationships and functional conservation. Below is a comparison with Blochmannia floridanus MsbA, another bacterial homolog:

FeatureAromatoleum aromaticum MsbABlochmannia floridanus MsbA
Protein length601 amino acids583 amino acids
Expression systemE. coliE. coli
TagN-terminal HisN-terminal His
Amino acid sequence similarityReference sequenceSignificant homology in conserved domains
ConservationHigh conservation in NBD regionsHigh conservation in NBD regions
Species-specific variationsUnique transmembrane domain adaptationsUnique transmembrane domain adaptations

Both proteins function as lipid A export ATP-binding/permease proteins but exhibit species-specific adaptations in their transmembrane domains, likely reflecting differences in membrane composition or substrate specificity between these bacterial species .

What experimental approaches can be used to study the ATP hydrolysis activity of Recombinant Aromatoleum aromaticum MsbA?

Studying the ATP hydrolysis activity of Recombinant Aromatoleum aromaticum MsbA requires specialized techniques to measure the functional aspects of this membrane protein. Recommended methodological approaches include:

  • Colorimetric ATPase assays:

    • Malachite green phosphate detection system

    • Measurement of inorganic phosphate release kinetics

    • Optimization of detergent concentration to maintain protein activity

  • Coupled enzyme assays:

    • Pyruvate kinase/lactate dehydrogenase system

    • Real-time monitoring of NADH oxidation at 340 nm

    • Calculation of ATP hydrolysis rates under various conditions

  • Experimental variables to optimize:

    • Detergent type and concentration

    • Lipid composition in mixed micelles

    • Temperature (typically 37°C for optimal activity)

    • pH range (typically 7.0-8.0)

    • Presence of potential substrates or inhibitors

For all assays, purified Recombinant Aromatoleum aromaticum MsbA should be reconstituted following the manufacturer's recommendations to ensure proper protein folding and activity .

How can Recombinant Aromatoleum aromaticum MsbA be incorporated into membrane models for functional studies?

For functional studies, Recombinant Aromatoleum aromaticum MsbA must be incorporated into membrane models that mimic its native environment. Several methodological approaches can be employed:

  • Liposome reconstitution:

    • Solubilize the lyophilized protein in a suitable detergent

    • Mix with preformed liposomes of defined lipid composition

    • Remove detergent via dialysis, Bio-Beads, or cyclodextrin

    • Verify incorporation using density gradient centrifugation

    • Assess protein orientation using protease protection assays

  • Nanodisc incorporation:

    • Mix purified MsbA with membrane scaffold proteins and lipids

    • Allow self-assembly of nanodiscs containing single MsbA proteins

    • Purify MsbA-containing nanodiscs by size exclusion chromatography

    • Verify incorporation by electron microscopy or analytical ultracentrifugation

  • Proteoliposome preparation for transport assays:

    • Incorporate fluorescent lipid A analogs into proteoliposomes

    • Initiate transport with ATP addition

    • Monitor changes in fluorescence as lipids are translocated

    • Analyze kinetics of transport under various conditions

When working with the recombinant protein, careful consideration must be given to the reconstitution process to maintain the protein's native conformation and functionality .

What are the challenges in crystallizing Recombinant Aromatoleum aromaticum MsbA for structural studies?

Crystallizing membrane proteins like Recombinant Aromatoleum aromaticum MsbA presents significant challenges due to their hydrophobic nature and conformational flexibility. Researchers should consider these key challenges and potential solutions:

  • Protein stability challenges:

    • The protein must be maintained in a stable, monodisperse state

    • Detergent selection is critical for maintaining native protein structure

    • The addition of 5-50% glycerol as recommended can improve stability

    • Consider lipid additives to mimic the native membrane environment

  • Crystallization strategies:

    • Vapor diffusion techniques with specialized membrane protein screens

    • Lipidic cubic phase crystallization for membrane proteins

    • Addition of antibody fragments or crystallization chaperones

    • Exploration of different constructs with modified terminal regions

  • Alternative structural methods:

    • Cryo-electron microscopy (single-particle analysis)

    • Small-angle X-ray scattering for solution structure

    • Hydrogen-deuterium exchange mass spectrometry for conformational studies

Successful crystallization typically requires extensive screening of conditions and often the modification of the protein construct to improve crystal packing without affecting the protein's native structure.

How does Recombinant Aromatoleum aromaticum MsbA interact with lipid A substrates?

Understanding the interaction between Recombinant Aromatoleum aromaticum MsbA and its lipid A substrates is essential for elucidating its transport mechanism. Several methodological approaches can be employed to study these interactions:

  • Binding assays:

    • Surface plasmon resonance with immobilized MsbA

    • Microscale thermophoresis for solution-based measurements

    • Fluorescence anisotropy with labeled lipid A analogs

    • Tryptophan fluorescence quenching to monitor conformational changes

  • Structural studies of substrate binding:

    • Site-directed mutagenesis of predicted binding site residues

    • Cross-linking studies followed by mass spectrometry

    • Molecular dynamics simulations using the sequence information

    • HDX-MS to identify regions with altered solvent accessibility upon substrate binding

  • Transport assays:

    • Reconstitution of MsbA into proteoliposomes

    • Inside-out vesicle preparations to study directionality

    • ATP-dependent transport monitoring with fluorescent lipid analogs

The unique amino acid sequence of Aromatoleum aromaticum MsbA suggests potential substrate-binding regions that can be targeted for mutagenesis studies to identify critical residues involved in lipid A recognition and transport.

What mutations in Recombinant Aromatoleum aromaticum MsbA affect its function, and how can these be studied?

Investigating structure-function relationships in Recombinant Aromatoleum aromaticum MsbA through site-directed mutagenesis provides valuable insights into its transport mechanism. Based on conserved motifs in ABC transporters, several key regions can be targeted:

  • Critical functional regions for mutation studies:

    • Walker A motif (P-loop): Crucial for ATP binding

    • Walker B motif: Essential for ATP hydrolysis

    • Signature C motif: Involved in ATP binding and hydrolysis

    • Q-loop: Couples ATP hydrolysis to conformational changes

    • Transmembrane coupling helices: Transmit conformational changes to TMDs

    • Substrate-binding residues in the transmembrane domains

  • Recommended mutation analysis methods:

    • ATPase activity assays to assess effects on ATP hydrolysis

    • Transport assays using reconstituted proteoliposomes

    • Thermal stability assays (differential scanning fluorimetry)

    • Limited proteolysis to assess conformational changes

    • Binding assays to determine effects on substrate affinity

  • Data interpretation framework:

    • Compare mutant activities to wild-type protein under identical conditions

    • Consider the impact on protein expression and stability

    • Correlate functional effects with structural predictions

    • Map mutations onto homology models based on related ABC transporters

For optimal results, express mutants using the same E. coli system and purification approach used for the wild-type protein to ensure comparable samples for analysis .

How can isothermal titration calorimetry be used to study substrate binding to Recombinant Aromatoleum aromaticum MsbA?

Isothermal Titration Calorimetry (ITC) provides a powerful tool for studying the thermodynamics of substrate binding to Recombinant Aromatoleum aromaticum MsbA. This technique can measure binding affinity, stoichiometry, and associated energy changes. The methodological approach involves:

  • Sample preparation for ITC:

    • Purify Recombinant Aromatoleum aromaticum MsbA to >90% purity as specified

    • Reconstitute in buffer without reducing agents or high salt

    • Dialyze protein and ligand in identical buffer to minimize heat of dilution

    • Degas all solutions to prevent bubble formation during titration

  • Experimental setup:

    • Load MsbA solution (10-20 μM) in the sample cell

    • Load lipid A or other substrate (100-200 μM) in the syringe

    • Perform control titrations (ligand into buffer) for baseline correction

    • Optimize temperature (typically 25°C) and stirring speed

  • Data analysis and interpretation:

    • Fit binding isotherms to appropriate models (single-site, multiple-site)

    • Determine binding constants (Ka), stoichiometry (n), and enthalpy (ΔH)

    • Calculate Gibbs free energy (ΔG) and entropy (ΔS) changes

    • Compare binding parameters under different conditions (pH, salt, temperature)

  • Challenges and considerations:

    • Detergent micelles can interfere with measurements

    • Lipid substrates may have limited solubility

    • Protein stability during titration must be verified

    • Multiple binding sites may complicate data interpretation

What are the reconstitution protocols for functional studies of Recombinant Aromatoleum aromaticum MsbA?

Proper reconstitution of Recombinant Aromatoleum aromaticum MsbA is essential for functional studies. The following detailed protocol can be used to reconstitute the protein while maintaining its activity:

  • Initial protein preparation:

    • Briefly centrifuge the lyophilized protein vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for stability

    • Aliquot and store at -20°C/-80°C for long-term storage

  • Detergent selection for solubilization:

    • Mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG

    • Detergent concentration should be above CMC but minimized

    • Incubate with gentle agitation for 1-2 hours at 4°C

  • Proteoliposome preparation:

    • Prepare lipid mixture (POPE:POPG at 3:1 ratio is often suitable)

    • Dry lipids and resuspend in buffer to form liposomes

    • Solubilize liposomes with detergent

    • Add purified MsbA at lipid-to-protein ratio of 20:1 to 100:1

    • Remove detergent using Bio-Beads SM-2 or dialysis

    • Collect proteoliposomes by ultracentrifugation

  • Functional validation:

    • Measure protein incorporation by SDS-PAGE analysis

    • Assess ATPase activity of reconstituted protein

    • Determine orientation using protease protection assays

    • Verify transport activity using fluorescent substrate analogs

This methodological approach ensures that the reconstituted Recombinant Aromatoleum aromaticum MsbA maintains its native structure and function for subsequent experimental studies.

How can Recombinant Aromatoleum aromaticum MsbA be used as a model for studying bacterial multidrug resistance?

Recombinant Aromatoleum aromaticum MsbA serves as an excellent model system for investigating bacterial multidrug resistance mechanisms, particularly those involving ABC transporters. The following methodological approaches can be employed:

  • Comparative studies with clinically relevant MDR transporters:

    • Sequence alignment with human P-glycoprotein and bacterial MDR ABC transporters

    • Structural comparison of substrate-binding pockets

    • Functional comparison of transport kinetics and substrate specificities

  • Drug interaction studies:

    • ATPase stimulation/inhibition assays with various antibiotics

    • Competition assays between lipid A and antimicrobial compounds

    • Transport assays using fluorescent drug analogs

    • Thermodynamic analysis of drug binding using ITC or SPR

  • Structure-function analysis focused on drug interactions:

    • Identification of residues involved in drug recognition

    • Site-directed mutagenesis of putative drug-binding sites

    • Creation of chimeric proteins with segments from clinical MDR transporters

    • Assessment of cross-resistance patterns

  • Application to drug development:

    • Screening for inhibitors of MsbA as potential adjuvants for existing antibiotics

    • Structure-based design of compounds targeting conserved functional domains

    • Development of high-throughput assays using the recombinant protein

By studying the mechanisms of substrate recognition and transport in Recombinant Aromatoleum aromaticum MsbA, researchers can gain insights into the fundamental principles governing multidrug resistance in pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.