Recombinant Aromatoleum aromaticum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Structure and Function

nuoK is a peripheral subunit of the NDH-I complex, which oxidizes NADH to reduce quinones while translocating protons across the membrane. In Aromatoleum aromaticum, this subunit (UniProt ID: Q5P1E0) spans 101 amino acids (1–101aa) and contains a hydrophilic N-terminal domain fused to a His-tag for purification .

Key Features:

  • Protein Length: Full-length (1–101aa) or partial variants (e.g., CSB-YP371838EJE1) .

  • Tagging: N-terminal His-tag for affinity chromatography .

  • Cofactors: No prosthetic groups; relies on interactions with other subunits for electron transfer .

Functional Role:
As part of NDH-I, nuoK contributes to:

  1. Electron Transfer: Facilitates the flow of electrons from NADH to ubiquinone.

  2. Proton Translocation: Supports the generation of a proton gradient for ATP synthesis .

Research Applications

Recombinant nuoK is utilized in:

Biochemical Assays

  • ELISA: Quantification of nuoK in bacterial lysates or purified fractions .

  • Enzyme Activity: Measuring NADH-quinone oxidoreductase activity in reconstituted systems .

Comparative Analysis

  • Homology: Aligns with E. coli NuoK (ND4L), a membrane-anchored subunit critical for complex stability .

  • Regulation: Investigating Fis/IHF-mediated transcriptional control of nuo operon genes .

Subunit Interactions

  • Membrane Integration: NuoK is part of the hydrophilic domain, interacting with NuoJ and NuoM to stabilize the complex .

  • Proton Pathway: Mutations in glycine residues (e.g., Gly140/Gly141) disrupt proton translocation in analogous subunits .

Challenges and Limitations

  • Low Yield: Full-length recombinant nuoK may require specialized protocols to ensure proper folding .

  • Solubility Issues: Hydrophobic regions may necessitate detergents (e.g., DDM) for membrane reconstitution .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery time information, please consult your local distributors.
As a standard practice, our proteins are shipped with normal blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
nuoK; AZOSEA27490; ebB168; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))
Target Names
nuoK
Target Protein Sequence
MLSLSHYLVLGAILFAISVVGIFLNRKNLIVLLMAIELMLLAVNLNFIAFSHYLGDLAGQ IFVFFILTVAAAESAIGLAILVVLFRNLRTIHVDDLDSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation. For every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, conserving redox energy in a proton gradient.
Database Links

KEGG: eba:ebB168

STRING: 76114.ebB168

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in Aromatoleum aromaticum?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the NADH dehydrogenase I complex (NDH-1) in Aromatoleum aromaticum strain EbN1 (previously known as Azoarcus sp. strain EbN1). This protein functions as part of the respiratory chain, facilitating electron transfer from NADH to quinones with the enzyme classification EC 1.6.99.5 . The protein is encoded by the nuoK gene (locus name AZOSEA27490, ORF name ebB168) and spans the expression region 1-101 .

As a subunit of the larger NADH dehydrogenase complex, nuoK contributes to energy generation in the cell through oxidative phosphorylation. The nuoK protein, along with other components of the nuo operon, plays a crucial role in the cell's ability to convert NADH to NAD+ and generate proton motive force, which is essential for ATP synthesis .

How does nuoK function within the broader NADH dehydrogenase complex?

In the NADH dehydrogenase complex (Complex I), nuoK operates as one of the membrane-embedded subunits. The complex as a whole catalyzes the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane to contribute to the proton gradient used for ATP synthesis .

Experimental evidence indicates that the nuo operon, which includes nuoK, can be downregulated under certain stress conditions, such as exposure to n-butanol. This downregulation leads to diminished ability to convert NADH to NAD+ and reduced proton motive force generation . This suggests that nuoK, as part of the NADH dehydrogenase complex, plays a critical role in maintaining cellular redox balance and energy production, particularly under different growth conditions and metabolic states.

What are the recommended storage conditions for recombinant nuoK protein?

For optimal preservation of recombinant Aromatoleum aromaticum nuoK protein activity, storage recommendations include:

  • Short-term storage: Maintain working aliquots at 4°C for up to one week

  • Standard storage: Store at -20°C in a buffer containing 50% glycerol

  • Long-term storage: Conserve at -20°C or -80°C in appropriate stabilization buffer (Tris-based buffer with 50% glycerol optimized for the protein)

It is important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity . To mitigate this risk, researchers should prepare small working aliquots for regular use while keeping the main stock under more stringent storage conditions.

What experimental approaches are most effective for studying nuoK protein expression under different growth conditions?

Based on proteomic studies with Aromatoleum aromaticum, a multi-faceted approach is recommended for studying nuoK expression:

  • Adaptation protocol: Prior to analysis, cells should be adapted for at least 5 passages to the desired growth conditions (aerobic or anaerobic) with specific substrates of interest .

  • Quantitative protein profiling: Techniques such as 2D DIGE (Two-Dimensional Difference Gel Electrophoresis) can effectively identify and quantify protein abundance changes under different conditions .

  • Integrated analysis: Combine protein identification with quantitative expression data to identify significant fold changes in protein abundance (typically using thresholds such as >2.5 fold for upregulation and <-2.5 fold for downregulation) .

  • Statistical validation: Apply principal component analysis (PCA) to ensure that observed protein regulation patterns represent specific biological responses rather than analytical artifacts .

This methodology allows researchers to systematically analyze how nuoK expression varies under different metabolic conditions, such as growth with different carbon sources or under varying oxygen availability.

How can researchers effectively purify recombinant nuoK for functional studies?

Purification of recombinant nuoK requires specialized techniques due to its membrane protein nature:

  • Expression system selection: Choose expression systems optimized for membrane proteins, possibly with fusion tags that facilitate purification while maintaining protein structure.

  • Detergent extraction: Carefully select detergents for membrane protein solubilization; commonly used options include n-dodecyl-β-D-maltoside (DDM) or digitonin for maintaining membrane protein integrity.

  • Affinity chromatography: Utilize tagged versions of the protein (the specific tag type should be determined during the production process to optimize for this specific protein) .

  • Buffer optimization: Maintain the protein in Tris-based buffers with 50% glycerol and additional stabilizing components customized for nuoK .

  • Quality control: Verify protein purity and integrity using techniques such as SDS-PAGE and Western blotting with antibodies specific to nuoK or the affinity tag.

What approaches can be used to investigate the role of nuoK in respiratory chain function?

To investigate the functional role of nuoK in respiratory chain activities, researchers can employ multiple complementary approaches:

  • Gene knockout/complementation studies: Generate nuoK deletion mutants in Aromatoleum aromaticum and assess the impact on growth under various respiratory conditions. Complementation with wild-type or mutated nuoK can verify functional relationships.

  • Enzyme activity assays: Measure NADH:quinone oxidoreductase activity in membrane preparations from wild-type and mutant strains using spectrophotometric methods tracking NADH oxidation or quinone reduction.

  • Membrane potential measurements: Use fluorescent dyes such as DiSC3(5) or JC-1 to evaluate the contribution of nuoK to membrane potential generation.

  • Transcriptomic analysis: Examine coordinated expression of nuoK with other genes from the nuo operon under various conditions, similar to analyses done with n-butanol stress that showed downregulation of oxidative-phosphorylation-related nuo operon genes .

  • Proteomic analysis: Apply quantitative proteomics to assess how nuoK abundance changes in response to environmental conditions, including different carbon sources and aerobic/anaerobic transitions .

These approaches collectively provide a comprehensive understanding of nuoK function in respiratory processes and energy metabolism.

How can researchers evaluate the impact of nuoK expression on cellular NADH/NAD+ ratios?

The evaluation of nuoK's impact on cellular NADH/NAD+ balance requires several complementary techniques:

  • Direct measurement of NADH/NAD+ ratios: Use enzymatic cycling assays or fluorescence-based detection methods to quantify intracellular NADH and NAD+ concentrations under conditions of varied nuoK expression.

  • Real-time monitoring: Employ genetically encoded NADH/NAD+ biosensors to track dynamic changes in redox balance in living cells.

  • Metabolic flux analysis: Use isotope-labeled substrates to trace metabolic pathways and determine how alterations in nuoK expression affect carbon flow through pathways that generate or consume NADH.

  • Transcriptional response analysis: Monitor expression changes in genes involved in redox balance maintenance, similar to observations where n-butanol stress affected not only the nuo operon but also led to upregulation of fructose and mannose metabolism-related genes (fucA, srlE, srlA) and downregulation of glycolysis/gluconeogenesis-related genes (pfkB, pgm) .

  • Integration with growth phenotypes: Correlate NADH/NAD+ ratio changes with growth parameters under various conditions, particularly focusing on conditions where electron transport chain function becomes limiting.

These methodologies provide insights into how nuoK contributes to cellular redox homeostasis under different metabolic and environmental conditions.

How does nuoK expression vary under different growth conditions in Aromatoleum aromaticum?

Proteomic studies with Aromatoleum aromaticum strain EbN1 have revealed distinct patterns of protein expression under various growth conditions. While specific data for nuoK was not directly provided in the search results, the general methodology for studying protein expression patterns offers valuable insights:

Analysis of differentially regulated proteins under various growth conditions showed that:

Growth ConditionSpecifically Down-regulated ProteinsSpecifically Up-regulated Proteins
Phenylalanine (anaerobic)5.3% (share of spots)4.9% (share of spots)
Phenylacetate (anaerobic)1.7%1.4%
Benzyl alcohol (anaerobic)2.1%5.4%
Benzaldehyde (anaerobic)1.4%4.7%
p-Cresol (anaerobic)3.5%8.6%
Phenol (anaerobic)7.1%8.7%
p-Hydroxybenzoate (anaerobic)3.4%3.9%

These patterns indicate that substrate-specific metabolic adaptations occur, involving differential regulation of numerous proteins including those involved in energy metabolism . For comprehensive analysis of nuoK regulation specifically, researchers should apply similar proteomic approaches focused on membrane protein fractions, where nuoK would be localized.

How does nuoK from Aromatoleum aromaticum compare to homologous proteins in other bacteria?

Comparative analysis of nuoK across bacterial species reveals important evolutionary and functional relationships:

This comparative approach helps researchers understand both the conserved functional core of nuoK and species-specific adaptations that may have evolved for particular ecological niches.

What role might nuoK play in the stress response mechanisms of Aromatoleum aromaticum?

The potential involvement of nuoK in stress response mechanisms presents a fascinating research direction:

Emerging evidence suggests that respiratory chain components, including NADH dehydrogenase subunits, may play significant roles in bacterial stress responses. In related research, n-butanol stress was found to cause quinone malfunction resulting in downregulation of the oxidative-phosphorylation-related nuo operon . This observation suggests that nuoK, as part of the nuo complex, may be involved in adaptive responses to environmental stressors.

Research approaches to investigate this question could include:

  • Exposing Aromatoleum aromaticum to various stressors (oxidative stress, membrane-disrupting compounds, pH extremes) and monitoring nuoK expression and the integrity of the NADH dehydrogenase complex.

  • Creating nuoK variants with altered expression levels to determine if modulated nuoK abundance affects stress tolerance.

  • Investigating whether nuoK undergoes post-translational modifications under stress conditions that might alter its function or interactions.

  • Examining potential moonlighting functions of nuoK beyond its canonical role in electron transport, possibly in membrane stabilization or protein-protein interactions relevant to stress response.

These investigations could reveal previously unrecognized roles for nuoK in cellular resilience and adaptation mechanisms.

How might nuoK function be engineered to enhance bioenergetic efficiency in bacterial systems?

Engineering nuoK to improve bioenergetic efficiency presents both challenges and opportunities:

Targeted modifications of nuoK could potentially enhance bacterial bioenergetics through several approaches:

  • Structure-guided mutagenesis: Using structural models or solved structures of homologous proteins to identify residues likely involved in proton translocation or quinone binding, followed by site-directed mutagenesis to optimize these interactions.

  • Proton pumping efficiency: Engineering variants with altered proton/electron stoichiometry to potentially improve energy conservation.

  • Stability enhancement: Introducing mutations that increase protein stability without compromising function, potentially leading to more robust electron transport chain activity under stress conditions.

  • Integration with synthetic biology approaches: Combining engineered nuoK with other optimized components of bioenergetic pathways, similar to approaches used for n-butanol production where ROS scavenging ability was enhanced by co-expressing OmpC-TMT .

  • Cross-species optimization: Transferring beneficial sequence features from nuoK homologs in extremophiles or highly efficient species to create hybrid proteins with enhanced performance.

The success of such engineering efforts would require careful functional validation, including growth phenotypes, direct measurements of electron transport rates, and assessment of proton pumping efficiency.

What experimental design considerations are most critical when studying nuoK in the context of metabolic engineering?

When incorporating nuoK studies into metabolic engineering projects, several experimental design considerations are paramount:

  • Naturalistic vs. controlled conditions: Traditional highly-controlled experimental paradigms may fail to capture the complexity of real-world contexts . A balance between control and ecological validity is necessary when studying nuoK function in metabolic engineering applications.

  • Multi-omics integration: Combine proteomics, transcriptomics, and metabolomics to understand the system-wide effects of nuoK modifications, as seen in the n-butanol production study where transcriptomic analysis revealed multiple affected KEGG pathways .

  • Temporal dynamics: Design experiments to capture time-dependent changes in nuoK expression and function, particularly important in dynamic processes like adaptation to new carbon sources or stress responses.

  • Statistical power and representative sampling: Ensure sufficient biological replicates while maintaining ecological relevance, recognizing that increased naturalistic complexity may introduce intercorrelations among variables .

  • Context-dependent function: Consider how the cellular environment, including membrane composition and respiratory chain component stoichiometry, may influence nuoK function and the interpretation of experimental results.

  • Within-subject design considerations: When possible, use experimental designs that allow for within-subject comparisons to reduce variability and increase statistical power, particularly important when working with complex phenotypes .

What are the most promising unexplored aspects of nuoK research?

Several underexplored aspects of nuoK research offer significant potential for future investigations:

  • Structural dynamics: Detailed studies of conformational changes in nuoK during the catalytic cycle could provide insights into the coupling mechanism between electron transfer and proton translocation.

  • Interaction network: Comprehensive mapping of nuoK interactions with other subunits of the NADH dehydrogenase complex and potentially with other cellular components could reveal unexpected functional relationships.

  • Regulatory mechanisms: Investigation of transcriptional, translational, and post-translational regulation of nuoK under different environmental conditions would enhance understanding of how cells modulate respiratory chain composition.

  • Role in microbial communities: Exploring how nuoK function contributes to competitive fitness in complex microbial communities could provide ecological context for its evolutionary conservation.

  • Biotechnological applications: Development of nuoK variants with enhanced stability or activity could contribute to improved biocatalysis or bioenergy applications, building on approaches similar to those used for n-butanol production enhancement .

These research directions would not only advance fundamental understanding of bacterial bioenergetics but could also contribute to applications in biotechnology and synthetic biology.

How might advanced imaging techniques contribute to a better understanding of nuoK function?

Advanced imaging methodologies offer powerful approaches to illuminate nuoK function:

  • Cryo-electron microscopy: High-resolution structural determination of the entire NADH dehydrogenase complex with nuoK in different functional states could reveal critical conformational changes during the catalytic cycle.

  • Super-resolution microscopy: Techniques such as PALM or STORM could track the distribution and dynamics of fluorescently tagged nuoK in living cells under various conditions.

  • Single-molecule FRET: Monitoring distance changes between strategically placed fluorophores could provide real-time information about nuoK conformational changes during electron transport.

  • Correlative light and electron microscopy (CLEM): This approach could link nuoK localization to ultrastructural features, particularly valuable for understanding its organization within the bacterial membrane.

  • Fluorescence lifetime imaging microscopy (FLIM): Could be used to study the local environment around nuoK and potentially detect interactions with other components of the respiratory chain.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.