Recombinant Aromatoleum aromaticum Probable intracellular septation protein A (AZOSEA37130)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant AZOSEA37130 is a full-length (202 amino acids) protein expressed in E. coli with an N-terminal His tag for purification . Its UniProt ID (Q5NYM6) and gene locus (AZOSEA37130, ebA6501) confirm its origin from A. aromaticum EbN1, a model organism for anaerobic aromatic compound degradation .

Comparative Context:

A. aromaticum EbN1 is renowned for anaerobic degradation of aromatic pollutants (e.g., phenol, p-cresol) , but AZOSEA37130’s role in these processes remains uncharacterized. Proteomic studies highlight EbN1’s metabolic flexibility , yet septation proteins like AZOSEA37130 are conspicuously absent from substrate-specific expression profiles .

Research Applications

Recombinant AZOSEA37130 is commercially available for:

  • Mechanistic Studies: Investigating bacterial cell division in A. aromaticum and related species.

  • Protein Interaction Assays: ELISA-based kits utilize this protein to probe binding partners .

  • Structural Biology: Serving as a substrate for crystallography or cryo-EM to resolve 3D architecture.

Limitations and Future Directions

  • Functional Data Gap: The protein’s exact role in septation or other cellular processes requires knockout/knockin studies.

  • Contextual Relevance: Links to EbN1’s aromatic degradation network remain unexplored .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; AZOSEA37130; ebA6501; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))
Target Names
AZOSEA37130
Target Protein Sequence
MKILFDLLPVILFFVAYKIAGGNQAFAHELASRWLGDGIAVTQAPILLATAVAILATIAQ IGWVWMRHRKVDTMLWISLAIIAVFGGATLFFHNPTFIKWKPTALYWLFGGTLTVSAVIF RRNLIRKMLEAQIRLPEPVWKRLNLAWAGFFILMGFLNLYVAYNFSEEAWVNFKLFGGMG LMLLFVLGQGFYLSRHIQEETT
Uniprot No.

Target Background

Function
This protein plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: eba:ebA6501

STRING: 76114.ebA6501

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the known synonyms and identifiers for this protein?

The protein is known by several alternative names and identifiers in different databases:

Identifier TypeValue
Gene NameAZOSEA37130
Protein NameProbable intracellular septation protein A
SynonymsyciB, ebA6501, Inner membrane-spanning protein YciB
UniProt IDQ5NYM6
Product CodeRFL25745AF (Creative BioMart)

Researchers should use these identifiers when searching literature databases or ordering recombinant versions of this protein to ensure correct identification .

What are the optimal expression systems for recombinant AZOSEA37130 protein?

  • Hydrophobicity profile analysis indicates multiple transmembrane domains, which can lead to toxicity in host cells

  • Codon optimization may be necessary when expressing in heterologous systems

  • Growth temperature modulation (typically lowering to 16-25°C after induction) can improve proper folding

  • Specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may yield better results

For researchers experiencing difficulty with E. coli expression, alternative eukaryotic systems such as yeast (P. pastoris) or insect cell lines may be considered, particularly if post-translational modifications are suspected to be important for function .

How can researchers optimize purification of recombinant AZOSEA37130 to maintain native conformation?

Purification of membrane proteins like AZOSEA37130 presents specific challenges that require careful optimization:

  • Solubilization protocol:

    • Use mild detergents (DDM, LDAO, or CHAPSO) at concentrations just above CMC

    • Include stabilizing agents such as glycerol (10-20%) in buffers

    • Maintain slightly alkaline pH (7.5-8.0) during extraction

  • Affinity purification:

    • For His-tagged constructs, use IMAC with increasing imidazole gradients

    • Consider using both N- and C-terminal tags to identify full-length protein

    • To avoid truncated products, increase imidazole concentration during elution

    • Purify at 4°C to minimize proteolysis

  • Quality control:

    • SDS-PAGE analysis under both reducing and non-reducing conditions

    • Size exclusion chromatography to confirm monodispersity

    • Circular dichroism to verify secondary structure integrity

When working with the commercial recombinant protein, reconstitution from the lyophilized form should follow manufacturer guidelines, using deionized sterile water to reach 0.1-1.0 mg/mL, with 5-50% glycerol added for storage stability .

What computational approaches can predict the membrane topology of AZOSEA37130?

For comprehensive membrane topology prediction of AZOSEA37130, researchers should employ multiple computational approaches:

  • Transmembrane helix prediction algorithms:

    • TMHMM, HMMTOP, and Phobius provide consensus predictions of transmembrane segments

    • For AZOSEA37130, predictions typically identify 5-6 transmembrane helices

  • Hydropathy analysis:

    • Kyte-Doolittle plots with a window size of 19-21 residues highlight hydrophobic regions

    • Regions with scores >1.8 typically correspond to transmembrane segments

  • AI-based structure prediction:

    • AlphaFold2 and RoseTTAFold can generate three-dimensional models

    • These models should be validated against experimental data when available

  • Conserved domain identification:

    • PFAM and InterPro scans identify the YciB domain common to this protein family

    • Conserved residues across homologs can indicate functional importance

A combined approach incorporating these methods provides more reliable predictions than any single method. For AZOSEA37130, the predicted topology suggests a multi-pass membrane protein with both N- and C-termini likely positioned in the cytoplasm, consistent with its proposed role in septation .

What experimental methods are recommended for validating the predicted function of AZOSEA37130?

To experimentally validate the predicted septation function of AZOSEA37130, researchers should consider multiple complementary approaches:

  • Genetic approaches:

    • Gene knockout or CRISPR-based deletion in Aromatoleum aromaticum

    • Complementation studies with wild-type and mutant variants

    • Microscopy analysis of cell division phenotypes in deletion strains

  • Localization studies:

    • Fluorescent protein fusions (ensuring the tag doesn't disrupt function)

    • Immunogold electron microscopy with specific antibodies

    • Co-localization with known division proteins (FtsZ, FtsA, etc.)

  • Interaction analyses:

    • Bacterial two-hybrid or split-GFP assays to identify binding partners

    • Co-immunoprecipitation with other septation proteins

    • Crosslinking studies followed by mass spectrometry

  • Structural biology:

    • Cryo-EM of reconstituted protein in nanodiscs or liposomes

    • Solid-state NMR to determine structural constraints

    • X-ray crystallography (challenging but possible with lipidic cubic phase)

These approaches should be combined with temporal studies during cell division to determine if AZOSEA37130 is recruited to the septum during specific stages of bacterial cell division .

How can researchers develop reliable assays to study AZOSEA37130 protein-protein interactions?

Developing reliable assays for studying AZOSEA37130 protein-protein interactions requires specialized approaches suitable for membrane proteins:

  • Membrane-based two-hybrid systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system specifically designed for membrane proteins

    • Split-ubiquitin yeast two-hybrid adapted for membrane protein interactions

  • In vitro reconstitution assays:

    • Label proteins with different fluorophores to measure FRET upon interaction

    • Reconstitute proteins in liposomes or nanodiscs to maintain native membrane environment

    • Surface plasmon resonance with captured His-tagged protein on NTA chips

  • Proximity labeling approaches:

    • BioID or TurboID fusions to identify proximal proteins in vivo

    • APEX2 peroxidase fusions for electron microscopy visualization

    • Quantitative mass spectrometry to analyze labeled proteins

  • Biophysical techniques:

    • Microscale thermophoresis for quantitative binding measurements

    • Analytical ultracentrifugation with fluorescence detection

    • Native MS for intact membrane protein complexes

Data validation should include negative controls with mutated binding interfaces and competition assays with unlabeled protein. Detergent selection is critical—use mild detergents like DDM or LMNG at concentrations that maintain the protein in a functional state .

What are the approaches for studying the role of AZOSEA37130 in bacterial septation?

To comprehensively study AZOSEA37130's role in bacterial septation, researchers should implement a multi-faceted experimental strategy:

  • Time-course microscopy:

    • Fluorescently tag AZOSEA37130 (ensuring the tag doesn't disrupt function)

    • Perform time-lapse microscopy during cell division

    • Co-visualize with FtsZ or membrane dyes to correlate with septum formation

  • Genetic manipulation studies:

    • Create depletion strains using inducible promoters to observe phenotypes

    • Analyze growth rate, cell morphology, and division defects upon depletion

    • Complement with wild-type and mutant variants to map functional domains

  • Biochemical characterization:

    • Assess membrane lipid binding preferences using liposome flotation assays

    • Test for enzymatic activities (peptidoglycan binding, modification, etc.)

    • Examine post-translational modifications that might regulate function

  • High-resolution imaging:

    • Cryo-electron tomography of dividing cells

    • Super-resolution microscopy (PALM/STORM) to precisely localize the protein

    • Correlative light and electron microscopy to connect function with ultrastructure

This comprehensive approach allows researchers to establish both the localization pattern and functional significance of AZOSEA37130 during bacterial cell division cycles .

How can researchers address protein aggregation issues with recombinant AZOSEA37130?

Protein aggregation is a common challenge when working with membrane proteins like AZOSEA37130. To address this issue:

  • Expression optimization:

    • Lower induction temperature (16-20°C) to slow protein production

    • Reduce inducer concentration to prevent overwhelming the membrane insertion machinery

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ) to aid folding

  • Buffer optimization:

    • Screen multiple detergents (DDM, LMNG, LDAO, etc.) at various concentrations

    • Include stabilizing agents like glycerol (10-20%) or specific lipids (PE, PG)

    • Test different pH values (typically 7.0-8.5) to find optimal stability

  • Purification strategies:

    • Incorporate a size exclusion chromatography step to remove aggregates

    • Consider adding low concentrations of cholesterol hemisuccinate or specific lipids

    • Use on-column detergent exchange during affinity purification

  • Analytical approaches:

    • Dynamic light scattering to monitor aggregation state

    • Analytical ultracentrifugation to characterize oligomeric distribution

    • Thermal shift assays to identify stabilizing conditions

When working with the commercial preparation, researchers should avoid repeated freeze-thaw cycles and follow the recommended reconstitution protocol using deionized sterile water to reach 0.1-1.0 mg/mL concentration with appropriate glycerol supplementation .

What are the potential pitfalls in functional studies of AZOSEA37130 and how can they be mitigated?

Functional studies of membrane proteins like AZOSEA37130 present several challenges that researchers should anticipate and address:

  • Expression system limitations:

    • Pitfall: Loss of function in heterologous hosts

    • Solution: Test multiple expression systems; co-express interaction partners

  • Fusion tag interference:

    • Pitfall: Tags disrupting protein localization or function

    • Solution: Use small tags; create both N- and C-terminal fusions; validate with tag-free protein

  • Reconstitution challenges:

    • Pitfall: Improper orientation in artificial membranes

    • Solution: Verify bidirectional incorporation; use oriented reconstitution techniques

  • Assay development:

    • Pitfall: Lack of suitable functional assays for uncharacterized proteins

    • Solution: Design phenotypic assays based on deletion strains; focus on localization during septation

  • Protein stability:

    • Pitfall: Degradation during experimental timeframes

    • Solution: Add protease inhibitors; optimize buffer conditions; perform time-course stability tests

  • Redundant functions:

    • Pitfall: No clear phenotype due to functional redundancy

    • Solution: Create multiple knockout combinations; overexpress to observe gain-of-function phenotypes

When designing experiments, researchers should include appropriate controls for each potential pitfall and validate any observed effects through multiple independent approaches .

How might AZOSEA37130 be utilized as a model for studying bacterial membrane protein biogenesis?

AZOSEA37130 represents an excellent model system for studying fundamental aspects of bacterial membrane protein biogenesis:

  • Membrane insertion pathways:

    • Investigate dependence on Sec vs. YidC pathways through depletion studies

    • Characterize the kinetics of membrane integration using pulse-chase experiments

    • Identify specific signal sequences or hydrophobic regions required for proper targeting

  • Folding and quality control:

    • Analyze involvement of periplasmic chaperones in proper folding

    • Study degradation pathways for misfolded variants

    • Examine how lipid composition affects folding efficiency

  • Evolutionary conservation:

    • Compare insertion mechanisms across diverse bacterial species

    • Identify conserved biogenesis factors through phylogenetic analysis

    • Develop predictive models for insertion efficiency based on sequence features

  • Methodological advances:

    • Develop real-time folding assays using split fluorescent proteins

    • Apply ribosome profiling to measure translation kinetics during membrane insertion

    • Establish reconstituted systems to study minimal requirements for insertion

This research direction would not only advance understanding of AZOSEA37130 specifically but would contribute to the broader field of membrane protein biology and potentially identify new antibiotic targets that disrupt membrane protein biogenesis .

What are the potential implications of AZOSEA37130 research for antimicrobial development?

Research on AZOSEA37130 holds several promising implications for antimicrobial development:

  • Target validation:

    • Determine essentiality of AZOSEA37130 and homologs across bacterial species

    • Characterize phenotypes resulting from protein depletion or inhibition

    • Identify specific functional domains that could be targeted by inhibitors

  • Structural insights for drug design:

    • Resolve high-resolution structures to identify potential binding pockets

    • Conduct molecular dynamics simulations to identify transient pockets

    • Perform fragment-based screening against purified protein

  • Screening approaches:

    • Develop cell-based assays using reporter fusions to monitor protein function

    • Create biochemical assays measuring specific activities (if identified)

    • Design phenotypic screens based on growth defects in depletion strains

  • Combination therapies:

    • Identify synergistic effects with established antibiotics

    • Explore potential for sensitizing bacteria to existing treatments

    • Investigate species-specific vulnerability to targeting this pathway

The bacterial cell division machinery represents an underexploited target for antibiotic development. As a probable component of this machinery, AZOSEA37130 research could lead to novel antimicrobial strategies, particularly valuable given the unique nature of this protein family and its absence in mammalian cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.