Recombinant Aromatoleum aromaticum UPF0761 membrane protein AZOSEA40600 (AZOSEA40600)

Shipped with Ice Packs
In Stock

Description

Introduction to the Compound

The Recombinant Aromatoleum aromaticum UPF0761 membrane protein AZOSEA40600 ( UniProt ID: Q5NXM9 ) is a genetically engineered protein derived from Aromatoleum aromaticum, a betaproteobacterium renowned for its anaerobic degradation of aromatic hydrocarbons . This recombinant protein is produced in heterologous hosts (e.g., E. coli) and is characterized by its membrane localization and potential role in bacterial metabolic pathways .

Key Features of AZOSEA40600

ParameterDetails
Source OrganismAromatoleum aromaticum (strain EbN1)
Host SystemE. coli, yeast, or baculovirus systems (varies by manufacturer)
TagHis-tag (standard), others may vary
Purity≥85% (SDS-PAGE validated)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (long-term); 4°C for working aliquots (up to 1 week)
Protein LengthFull-length (1–407 amino acids)

Comparative Analysis with Related Proteins

FeatureAZOSEA40600Membrane-Anchored Proteins (General)
LocalizationPredicted membrane-boundIntegral or peripheral membrane
FunctionHypothetical transport/regulationTransport, signaling, enzymatic activity
Detection MethodsELISA, SDS-PAGE Immunoblotting, cryo-EM, X-ray crystallography

Experimental Uses

  • ELISA Kits: Used as a target antigen in immunoassays for detecting antibodies or studying protein interactions .

  • Protein Stability Studies: Analysis of folding, aggregation, or thermal stability under varying conditions .

  • Membrane Protein Studies: Structural characterization using ProtRAP-LM, a computational tool for identifying membrane-anchored proteins .

Case Study: ProtRAP-LM Analysis

ProtRAP-LM, a deep-learning model, identifies membrane localization by analyzing residue-level accessibility. For AZOSEA40600, this method could:

  1. Confirm Membrane Anchoring: Validate predicted transmembrane helices or β-sheets.

  2. Identify Interaction Sites: Highlight regions with high solvent accessibility for ligand binding .

Challenges and Knowledge Gaps

  • Functional Ambiguity: No direct experimental evidence links AZOSEA40600 to specific pathways (e.g., benzoate degradation, phenol metabolism) .

  • Host Dependency: Recombinant expression may alter native folding or functionality, necessitating validation in A. aromaticum .

  • Limited Structural Data: No crystallographic or cryo-EM structures are publicly available.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. For dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
AZOSEA40600; ebA7158; UPF0761 membrane protein AZOSEA40600
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))
Target Names
AZOSEA40600
Target Protein Sequence
MMPLTAAREFMRLLTGRFLATRCPQVAGSLAFTTLLAIVPLLTVIIALFSNFPAFSRLGE SLRTFLLENLLPDRAGQIIATYAFQFSQQAAGLTLIGTVLLVLTALMLLMTIDHVFNHIW GVRRPRPLLTRLMVHWFALTLGPLALGGSVLATGHLVATSIALAGEGSWVGATFARLVPT VLLGSLFSVLYYAVPNHPVRMLHALAGGIAAAIVFVLMQRLFGLFIVRIPTYTLIYGTFA VLPIFLVWLYLSWVVILLGAALSATLPSFFERARILRAFPGDRAWAAVTMLIALADAQHA GTTLPFATLQAGARVSSNEGEALLGEMRDAGWVAHTEEGNWLLSRQAAQIGLAAVVNRFA LSPAAWREASDGDEASRRIAERLATALHSADLPLSALTSAGNRVQTG
Uniprot No.

Target Background

Database Links

KEGG: eba:ebA7158

STRING: 76114.ebA7158

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant AZOSEA40600 protein?

Bacterial Expression Systems:

  • E. coli BL21(DE3) with specialized vectors like pET or pBAD for membrane protein expression

  • C41(DE3) and C43(DE3) strains specifically engineered for toxic membrane protein expression

  • Codon optimization based on the target organism

Eukaryotic Expression Systems (for functional studies):

  • Yeast (P. pastoris, S. cerevisiae) for proper folding and post-translational modifications

  • Insect cell expression systems (Sf9, High Five) using baculovirus vectors

  • Mammalian cell lines for complex membrane proteins requiring specific lipid environments

Experimental Design Consideration: When designing expression experiments, implement a factorial design approach to test multiple variables simultaneously (temperature, inducer concentration, media composition) to determine optimal expression conditions. This methodological approach allows for statistical analysis of interaction effects between variables.

What methods are recommended for purification and purity assessment of recombinant AZOSEA40600?

Purification of membrane proteins like AZOSEA40600 requires specialized techniques to maintain structural integrity. The following methodological workflow is recommended:

  • Membrane Fraction Isolation:

    • Differential centrifugation following cell lysis

    • Sucrose gradient ultracentrifugation for membrane fraction enrichment

  • Detergent Solubilization:

    • Screen multiple detergents (DDM, LDAO, Triton X-100) at various concentrations

    • Optimize solubilization conditions (time, temperature, buffer composition)

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Tandem affinity purification if multiple tags are incorporated

  • Additional Purification Steps:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Purity Assessment:

    • SDS-PAGE with Coomassie/silver staining (>90% purity standard)

    • Western blotting using anti-His antibodies

    • Mass spectrometry for identity confirmation

Creating a detailed purification table recording yields and purity at each step enables optimization of the protocol for maximum protein recovery while maintaining structural integrity.

What are the optimal storage conditions for maintaining AZOSEA40600 stability?

Long-term stability of purified AZOSEA40600 is critical for experimental reproducibility. Based on available data and general membrane protein handling principles:

Recommended Storage Conditions:

  • Store at -20°C/-80°C after initial receipt

  • Avoid repeated freeze-thaw cycles by creating working aliquots stored at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 as a storage buffer

Reconstitution Protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended) before aliquoting for long-term storage

Stability Assessment:
Researchers should periodically verify protein integrity through:

  • SDS-PAGE analysis

  • Activity assays (if available)

  • Circular dichroism to monitor secondary structure changes

How can experimental design principles be applied to study the membrane localization of AZOSEA40600?

Studying membrane localization requires robust experimental design incorporating multiple complementary approaches. A comprehensive experimental design should follow these principles:

  • Establish Clear Hypotheses and Variables:

    • Independent variables: Expression conditions, membrane fractions, cellular compartments

    • Dependent variables: Protein localization patterns, membrane association strength

    • Control variables: Cell growth conditions, expression levels, detection methods

  • Multi-Method Validation Strategy:

    • Fluorescence microscopy with GFP-tagged AZOSEA40600

    • Subcellular fractionation followed by Western blotting

    • Protease protection assays to determine membrane topology

    • Density gradient centrifugation for membrane microdomain analysis

  • Statistical Analysis Framework:

    • Multiple experimental replicates (n≥3)

    • Appropriate statistical tests for significance determination

    • Quantitative image analysis for fluorescence distribution

This experimental design approach isolates the variables affecting localization by systematically testing each condition against appropriate controls, similar to the basic principle of isolating causative factors in experimental design 6.

What techniques can resolve structural features of AZOSEA40600 given the challenges of membrane protein crystallization?

Membrane proteins like AZOSEA40600 present significant crystallization challenges. Researchers should consider these methodological approaches:

X-ray Crystallography Optimization:

  • Detergent screening (>20 different detergents at varying concentrations)

  • Lipidic cubic phase crystallization

  • Antibody fragment co-crystallization to increase polar surface area

  • Construct optimization (removal of flexible regions, thermostabilizing mutations)

Alternative Structural Determination Methods:

  • Cryo-Electron Microscopy:

    • Single particle analysis for proteins >150 kDa

    • 2D crystallization in lipid bilayers

  • NMR Spectroscopy:

    • Solution NMR for smaller membrane proteins

    • Solid-state NMR for proteins in native-like lipid environments

  • Molecular Dynamics Simulations:

    • Homology modeling based on structurally characterized UPF0761 family members

    • Refinement through molecular dynamics in simulated membrane environments

A hybrid approach combining low-resolution experimental data with computational refinement often yields the most comprehensive structural insights for challenging membrane proteins.

How can protein-protein interaction networks involving AZOSEA40600 be systematically mapped?

Mapping protein-protein interactions (PPIs) for membrane proteins requires specialized techniques. A systematic experimental approach includes:

In Vitro Methods:

  • Pull-down Assays:

    • Use the His-tagged AZOSEA40600 as bait protein

    • Analyze binding partners via mass spectrometry

    • Validate with reciprocal pull-downs

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking of proximal proteins in native membranes

    • MS/MS analysis to identify crosslinked peptides

    • Structural mapping of interaction interfaces

In Vivo Methods:

  • Split-Ubiquitin Membrane Yeast Two-Hybrid:

    • Specifically designed for membrane protein interactions

    • Screen against genomic or focused libraries

  • Proximity Labeling:

    • APEX2 or BioID fusion to AZOSEA40600

    • Temporal control of labeling to capture transient interactions

    • Quantitative proteomics to identify proximity partners

Network Analysis:

  • Apply graph theory to visualize and analyze interaction networks

  • Identify functional clusters of interacting proteins

  • Integrate with transcriptomic data for context-specific networks

This multi-method approach increases confidence in identified interactions through orthogonal validation, essential for membrane proteins where false negatives are common with single-method approaches.

How can site-directed mutagenesis be employed to investigate the functional domains of AZOSEA40600?

Site-directed mutagenesis is a powerful approach for functional domain mapping. For AZOSEA40600, a strategic experimental design would include:

Systematic Mutation Design:

  • Sequence-based targeting:

    • Conserved residues across UPF0761 family members

    • Predicted functional motifs based on the amino acid sequence

    • Transmembrane regions and potential active sites

  • Structure-guided mutations:

    • Charged residues in predicted transmembrane regions

    • Potential ligand-binding pockets

    • Interface residues for protein-protein interactions

Experimental Validation of Mutants:

  • Expression level and membrane localization assessment

  • Structural integrity verification (CD spectroscopy, thermal stability)

  • Function-specific assays based on predicted protein role

Data Organization and Analysis:

  • Create a comprehensive mutation database tracking:

    • Mutation position and type

    • Expression/folding effects

    • Functional consequences

    • Structural impacts

MutationPositionDomainExpressionMembrane LocalizationFunctional Impact
R25A25N-termNormalNormalReduced activity
W120A120TM3ReducedMislocalizedLoss of function
D200N200LoopNormalNormalNo effect

This systematic mutagenesis approach, combined with rigorous experimental design principles, allows for statistical correlation between specific residues and functional outcomes.

What computational approaches can reliably predict structure-function relationships of AZOSEA40600?

In the absence of experimental structural data, computational approaches provide valuable insights. A comprehensive computational workflow includes:

Sequence-Based Predictions:

  • Homology Modeling:

    • Identify structural templates using HHpred, SWISS-MODEL

    • Generate multiple models with varying templates/algorithms

    • Validate models using PROCHECK, VERIFY3D

  • Ab Initio and Threading Methods:

    • AlphaFold2 or RoseTTAFold for novel fold prediction

    • I-TASSER for template-free modeling

    • CABS-fold for coarse-grained modeling

Functional Annotation:

  • Conserved domain analysis using InterPro, Pfam

  • Transmembrane topology prediction (TMHMM, Phobius)

  • Functional residue prediction using ConSurf, DEPTH

Molecular Dynamics Simulations:

  • Membrane embedding using CHARMM-GUI

  • Explicit solvent simulations in lipid bilayers

  • Analysis of stability, conformational changes, and potential binding sites

Experimental Validation Strategy:

  • Design experiments to test computational predictions

  • Refine models based on experimental feedback

  • Establish confidence levels for different prediction aspects

This integrative computational approach provides testable hypotheses about structure-function relationships that guide experimental design, creating an iterative process of computational prediction and experimental validation.

What isotope labeling strategies are most effective for NMR studies of AZOSEA40600?

NMR studies of membrane proteins like AZOSEA40600 require specialized isotope labeling approaches. A methodological framework includes:

Uniform Labeling Strategies:

  • Triple Labeling (13C, 15N, 2H):

    • Expression in M9 minimal media with 13C-glucose, 15N-ammonium chloride

    • Deuteration (70-90%) to improve relaxation properties

    • Selective protonation of methyl groups for improved signal detection

  • SAIL (Stereo-Array Isotope Labeling):

    • Incorporation of stereospecifically labeled amino acids

    • Reduction of spectral complexity while maintaining structural information

Selective Labeling Approaches:

  • Amino Acid-Specific Labeling:

    • Label only specific amino acid types (e.g., 15N-Leu, 13C-Val)

    • Focus on residues in predicted functional regions

  • Segmental Labeling:

    • Express protein domains separately with different isotope patterns

    • Ligate using split inteins or native chemical ligation

Sample Preparation Considerations:

  • Detergent micelles vs. nanodiscs vs. bicelles

  • Paramagnetic relaxation enhancement (PRE) for distance constraints

  • Oriented sample preparation for solid-state NMR

This methodical approach to isotope labeling optimizes signal quality while reducing spectral complexity, essential for the structural characterization of complex membrane proteins.

How can reconstitution systems be optimized to study AZOSEA40600 in near-native membrane environments?

Studying membrane proteins in native-like environments is crucial for functional understanding. A systematic approach to membrane reconstitution includes:

Liposome Reconstitution:

  • Lipid Composition Screening:

    • Bacterial membrane mimics (POPE/POPG mixtures)

    • Systematic variation of lipid types and ratios

    • Incorporation of specific lipids based on native environment

  • Reconstitution Methods:

    • Detergent removal via dialysis or Bio-Beads

    • Direct incorporation during liposome formation

    • Fusion of proteoliposomes with preformed liposomes

Nanodiscs and Membrane Scaffold Proteins:

  • Choose appropriate MSP constructs based on protein size

  • Optimize lipid:protein:MSP ratios

  • Validate homogeneity by size exclusion chromatography and electron microscopy

Functional Validation:

  • Circular dichroism to confirm secondary structure integrity

  • Fluorescence spectroscopy to assess tertiary structure

  • Functional assays specific to predicted protein activity

Experimental Design Considerations:

  • Implement factorial design to test multiple variables

  • Control for protein orientation during reconstitution

  • Establish quantitative metrics for reconstitution efficiency

This methodological framework enables systematic optimization of membrane environments that maintain protein stability and activity, essential for accurate functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.