Recombinant Artemia franciscana NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

ND3 is a core subunit of mitochondrial Complex I (NADH dehydrogenase), which catalyzes electron transfer from NADH to ubiquinone, coupled with proton translocation . Key features include:

PropertyDetail
Gene NameND3 (mitochondrially encoded)
Protein Length120 amino acids (predicted from recombinant constructs)
Recombinant HostEscherichia coli (E. coli)
TagN-terminal His tag for purification
Enzyme Commission NumberEC 7.1.1.2 (shared with Complex I)
UniProt IDP48911 (Artemia franciscana ND3)

Recombinant Production and Applications

Recombinant ND3 is synthesized to study mitochondrial dysfunction, oxidative phosphorylation, and evolutionary adaptations in extremophiles like Artemia franciscana . Commercial sources highlight its use in:

  • Structural studies of Complex I assembly .

  • Functional assays to probe electron transport chain efficiency .

  • Comparative genomics due to Artemia’s unique anhydrobiotic capabilities .

Genomic Context and Evolutionary Insights

The mitochondrial genome of A. franciscana encodes ND3 alongside other electron transport chain subunits . Key genomic traits:

  • Gene arrangement: ND3 is transcribed from the light strand, flanked by tRNA-Val and ND4L .

  • AT/GC skew: ND3 exhibits negative AT-skew (−0.165) and GC-skew (−0.053), consistent with mitochondrial gene bias .

  • Evolutionary divergence: Comparative mitogenomic analyses reveal high sequence conservation among Artemia species, suggesting functional constraints .

Future Research Directions

Key unanswered questions include:

  • Structural resolution of ND3 within the Artemia Complex I holocomplex.

  • Role of ND3 in anhydrobiosis-linked metabolic suppression .

  • Impact of ND3 mutations on mitochondrial disease models.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ND3; ND-3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Artemia franciscana (Brine shrimp) (Artemia sanfranciscana)
Target Names
ND3
Target Protein Sequence
MILIWLSIFMLVFIMLTLGMFVNKKVSLDREKSSPFECGFDPLNSSRTPFSIRFFVITLI FLIFDVEIYLLLPMVYLNMSSPTTYLIIFFTFILVAGVFYEWSEGALSWIK
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered a critical component for the minimal assembly required for catalytic activity. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 (ND3) and what is its role in Artemia franciscana?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). In Artemia franciscana, as in other organisms, this protein plays a critical role in the electron transport chain, specifically in the transfer of electrons from NADH to ubiquinone . The protein is encoded by the mitochondrial gene ND3 and is essential for energy production through oxidative phosphorylation. The full-length protein consists of 111 amino acids and functions within the inner mitochondrial membrane as part of the proton-pumping machinery .

How does Artemia franciscana ND3 compare structurally and functionally to ND3 proteins from other organisms?

Artemia franciscana ND3 shares structural and functional similarities with homologous proteins from other organisms, but with species-specific variations. Compared to other crustaceans and arthropods, A. franciscana ND3 exhibits evolutionary conservation in key functional domains while displaying sequence divergence in less critical regions. When compared to the Pichia canadensis ND3, which consists of 148 amino acids, A. franciscana ND3 is shorter at 111 amino acids, suggesting potential structural differences while maintaining core functional domains .

The protein maintains the conserved functional domains necessary for electron transport and proton pumping activities common to Complex I components across species. Phylogenetic analysis places A. franciscana in Group A along with other American origin Artemia species, showing closer evolutionary relationships with these species than with Mediterranean species like A. salina .

What are the optimal conditions for expression and purification of recombinant Artemia franciscana ND3?

For optimal expression of recombinant A. franciscana ND3, E. coli expression systems similar to those used for other mitochondrial membrane proteins can be employed. Based on protocols for similar proteins:

  • Expression system: BL21(DE3) E. coli strain with a pET expression vector containing the codon-optimized ND3 sequence

  • Induction conditions: 0.5-1.0 mM IPTG at 16-18°C for 16-20 hours to reduce inclusion body formation

  • Solubilization: Membrane fraction isolation followed by solubilization with mild detergents such as DDM (n-dodecyl β-D-maltoside) or LDAO (lauryldimethylamine oxide)

  • Purification: Immobilized metal affinity chromatography (IMAC) using His-tagged protein, followed by size exclusion chromatography

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week.

What methods are most effective for studying the functional activity of recombinant ND3 protein?

Several methodological approaches are recommended for studying the functional activity of recombinant A. franciscana ND3:

  • Electron transfer assays: Using artificial electron acceptors like ferricyanide to measure NADH oxidation rates spectrophotometrically

  • Reconstitution studies: Incorporating purified ND3 into liposomes with other Complex I components to assess proton pumping activity

  • Site-directed mutagenesis: Identifying critical residues by systematic mutation and functional analysis

  • Protein-protein interaction studies: Co-immunoprecipitation or crosslinking experiments to determine interactions with other Complex I subunits

  • Membrane potential measurements: Using fluorescent probes to assess the contribution of ND3 to membrane potential generation

Inhibitor studies using specific Complex I inhibitors such as rotenone or piericidin A can provide insights into the specific role of ND3 within the complex. Assessment of electron transfer rates under various conditions (pH, temperature, substrate concentration) can yield valuable kinetic parameters .

How can researchers overcome challenges in expressing and maintaining stability of hydrophobic membrane proteins like ND3?

Expressing and maintaining stability of hydrophobic membrane proteins like ND3 presents several challenges that can be addressed using the following strategies:

Table 1: Strategies for Improving Membrane Protein Expression and Stability

ChallengeStrategyImplementation
Poor expressionCodon optimizationAdapt codons to E. coli preference
Fusion tagsMBP, SUMO, or Mistic fusion to improve folding
Low temperature inductionInduce at 16-18°C to slow folding process
Inclusion body formationDetergent screeningTest panel of 8-12 detergents for solubilization
Chaperone co-expressionCo-express with GroEL/ES, DnaK, or Trigger Factor
Protein instabilityLipid supplementationAdd specific phospholipids to purification buffers
Styrene maleic acid lipid particles (SMALPs)Extract protein with native lipid environment
Aggregation during storageGlycerol additionStore with 50% glycerol to prevent aggregation
Small aliquotsPrepare small working aliquots to minimize freeze-thaw

Additionally, cell-free expression systems can be considered for particularly challenging membrane proteins, as they allow direct incorporation into liposomes or nanodiscs during synthesis .

What role does ND3 play in the exceptional anoxia tolerance of Artemia franciscana embryos?

Artemia franciscana embryos are renowned for their extraordinary ability to survive anoxic conditions through profound metabolic downregulation. ND3, as a component of Complex I, likely plays a significant role in this adaptation:

  • During anoxia, A. franciscana embryos experience a dramatic intracellular acidification (>1.6 pH units), which is critical for metabolic suppression .

  • As oxygen levels decrease, electron transport through Complex I (including ND3) would be affected, potentially triggering conformational changes in the complex.

  • These changes might contribute to the redistribution of protons within the cell, supporting the intracellular acidification necessary for anoxic survival.

  • Evidence suggests that under anoxic conditions, reverse electron transport may occur through Complex I, which could involve altered functioning of ND3.

The specialized role of ND3 in A. franciscana may be related to structural adaptations that allow Complex I to respond appropriately to oxygen limitation, potentially through interaction with other mitochondrial components like V-ATPase, which has been demonstrated to be expressed in encysted embryos and is believed to contribute to the intracellular acidification observed during anoxia .

How does the expression of ND3 vary during different developmental stages of Artemia franciscana?

Based on studies of similar mitochondrial components in A. franciscana, ND3 expression likely varies significantly throughout development stages:

  • Encysted embryos: Likely maintains baseline expression levels as part of the minimal metabolic machinery required during dormancy.

  • Early development: Expression likely increases substantially during early development as metabolic demands increase and mitochondrial biogenesis accelerates.

  • Nauplii stages: Continued high expression to support the energy demands of rapid growth and development.

  • Adult stage: Modulated expression based on environmental conditions and metabolic requirements.

Similar to V-ATPase expression patterns in A. franciscana, which show differential expression throughout early development , ND3 expression is likely regulated in coordination with other components of the electron transport chain to meet changing energy demands during life cycle transitions. Quantitative analysis of ND3 mRNA levels throughout development would provide a more precise expression profile.

What experimental approaches can be used to study the interaction between ND3 and other subunits of Complex I?

To investigate interactions between ND3 and other Complex I subunits, researchers can employ the following experimental approaches:

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify proteins in proximity to ND3

  • Co-immunoprecipitation: Using antibodies against ND3 to pull down interacting proteins

  • Blue native PAGE: To analyze intact Complex I and subcomplexes containing ND3

  • Fluorescence resonance energy transfer (FRET): To detect direct protein-protein interactions in reconstituted systems

  • Surface plasmon resonance (SPR): For measuring binding kinetics between purified ND3 and other subunits

  • Cryo-electron microscopy: To visualize the structural arrangement of ND3 within the assembled Complex I

These approaches can reveal both the static structural relationships and dynamic interactions that occur during the catalytic cycle of Complex I. Comparative analysis between A. franciscana ND3 interactions and those from other species can highlight unique adaptations that may contribute to the exceptional physiological capabilities of this organism .

How can researchers use recombinant Artemia franciscana ND3 to study mitochondrial dysfunction in disease models?

Recombinant A. franciscana ND3 offers unique opportunities for studying mitochondrial dysfunction in disease models due to the exceptional adaptability of Artemia to extreme conditions:

  • Comparative structural studies: Structural differences between human and A. franciscana ND3 can provide insights into disease-causing mutations in human ND3.

  • Functional complementation: Testing whether A. franciscana ND3 can rescue function in cell lines harboring human ND3 mutations.

  • Chimeric proteins: Creating chimeric proteins with domains from human and A. franciscana ND3 to identify critical functional regions.

  • Stress response mechanisms: Investigating how A. franciscana ND3 responds to oxidative stress compared to homologs from organisms without extreme stress tolerance.

  • Bioenergetic analysis: Comparing bioenergetic parameters of cells expressing wild-type human ND3 versus A. franciscana ND3 under various stressors.

These approaches can yield insights into the molecular basis of mitochondrial diseases involving Complex I dysfunction and potentially identify novel therapeutic strategies based on the unique adaptations present in A. franciscana ND3 .

What evolutionary insights can be gained from comparing ND3 sequences across different Artemia species?

Phylogenetic analysis of ND3 sequences across Artemia species provides valuable evolutionary insights:

  • Molecular clock analysis: ND3 sequence divergence can be used to estimate divergence times between Artemia species and lineages.

  • Selection pressure analysis: Examination of the ratio of non-synonymous to synonymous substitutions (dN/dS) in ND3 can reveal regions under positive or purifying selection.

  • Adaptation signatures: Identification of amino acid substitutions unique to specific Artemia lineages may reveal adaptations to different environmental conditions.

  • Coevolution patterns: Analysis of correlated mutations between ND3 and other mitochondrial proteins can identify co-evolving residues.

Comparative analysis shows that A. franciscana clusters in Group A along with other American origin Artemia and some Asian origin Artemia, distinct from Group B (exclusively Asian origin Artemia) and Group C (Mediterranean A. salina) . These groupings suggest complex evolutionary histories possibly influenced by geographical separation and environmental adaptations. The high conservation of functional domains in ND3 across these groups indicates the critical nature of its role in cellular respiration.

How do mutations in ND3 affect the assembly and function of Complex I in Artemia franciscana compared to other organisms?

Mutations in ND3 can significantly impact Complex I assembly and function, with effects that may differ between A. franciscana and other organisms:

Table 2: Comparative Effects of ND3 Mutations on Complex I

Mutation TypeEffect in Standard Model OrganismsPotential Effect in A. franciscanaExperimental Approach
Conserved residues in proton channelSevere impairment of proton pumpingMay show compensatory mechanisms due to anoxia adaptationSite-directed mutagenesis with bioenergetic assays
Ubiquinone-binding domainReduced electron transfer efficiencyPossibly altered quinone affinity adapted to function in extreme conditionsEnzyme kinetics with various quinone analogs
Membrane-spanning regionsAssembly defectsPotentially more robust assembly due to evolutionary adaptationsBlue native PAGE and assembly kinetics analysis
Inter-subunit contact sitesDestabilized complexMay have evolved additional stabilizing interactionsCross-linking and thermal stability assays

The unique physiological capabilities of A. franciscana suggest that its Complex I, including ND3, may have evolved distinctive properties that allow function under extreme conditions. Comparative analysis of the effects of equivalent mutations in A. franciscana versus mammalian ND3 could reveal important insights into the structure-function relationships of Complex I and mechanisms of robustness against environmental stressors .

What techniques are most appropriate for analyzing the interaction of ND3 with inhibitors and potential therapeutic compounds?

For analyzing interactions between A. franciscana ND3 and inhibitors or therapeutic compounds, researchers should consider these specialized techniques:

  • Isothermal titration calorimetry (ITC): For direct measurement of binding thermodynamics between purified ND3 and small molecules

  • Microscale thermophoresis (MST): To detect binding interactions with minimal protein consumption

  • Saturation transfer difference (STD) NMR: For mapping the binding epitope of small molecules on ND3

  • Thermal shift assays: To assess stabilization or destabilization of ND3 upon compound binding

  • Activity-based assays: Measuring changes in electron transfer rates in reconstituted systems containing ND3 and other Complex I components

  • Computational docking and MD simulations: To predict binding modes and energetics of compound interactions

These methods can be particularly valuable when investigating how the unique structural features of A. franciscana ND3 affect interactions with known Complex I inhibitors compared to homologs from other species. This information may guide the development of selective inhibitors or identify novel binding sites for therapeutic targeting of Complex I in various disease contexts .

How can isotope labeling be utilized to study the structure and dynamics of recombinant ND3?

Isotope labeling provides powerful approaches for structural and dynamic studies of membrane proteins like ND3:

  • Uniform 15N/13C labeling: By expressing ND3 in E. coli grown in minimal media with 15NH4Cl and 13C-glucose as sole nitrogen and carbon sources, researchers can prepare samples for multidimensional NMR studies.

  • Selective amino acid labeling: Expression in media containing specific labeled amino acids allows focused analysis of particular regions of interest in ND3.

  • Deuteration: Growing expression cultures in D2O-based media produces deuterated protein, which can improve NMR spectra quality by reducing certain relaxation pathways.

  • Methyl-TROSY NMR: Selective labeling of methyl groups in a deuterated background enables studies of dynamics in this large membrane protein complex.

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS): To probe solvent accessibility and conformational changes under different conditions.

These approaches can provide crucial information about the structure, dynamics, and conformational changes of ND3 during its functional cycle and in response to inhibitors or mutations. The data obtained can complement cryo-EM and X-ray crystallographic studies of the entire Complex I .

What considerations are important when designing experiments to study post-translational modifications of ND3 in Artemia franciscana?

When investigating post-translational modifications (PTMs) of ND3 in A. franciscana, researchers should consider several key experimental design factors:

  • Sample preparation protocols: Ensure extraction methods preserve labile PTMs; use phosphatase inhibitors for phosphorylation studies and deacetylase inhibitors for acetylation studies.

  • Enrichment strategies: Implement affinity-based enrichment for specific PTMs (e.g., titanium dioxide for phosphopeptides, antibody-based enrichment for acetylated peptides).

  • Mass spectrometry approaches: Use electron transfer dissociation (ETD) or electron capture dissociation (ECD) fragmentation methods that preserve PTMs during analysis.

  • Developmental timing: Sample collection should account for potential changes in PTM patterns during different developmental stages of A. franciscana.

  • Environmental conditions: Consider how extreme conditions (anoxia, salinity changes) might affect PTM patterns; design experiments with appropriate controls.

  • Site-directed mutagenesis: Mutate putative modification sites to assess functional significance.

Comparative analysis of PTM patterns between A. franciscana ND3 and homologs from other species may reveal unique modifications that contribute to the exceptional stress tolerance of this organism. Integration of PTM data with functional assays can establish the physiological relevance of identified modifications .

How might CRISPR/Cas9 genome editing be applied to study ND3 function in Artemia franciscana?

CRISPR/Cas9 technology offers revolutionary approaches to study ND3 function in A. franciscana, though with unique considerations for mitochondrial genes:

  • Indirect approaches for mitochondrial DNA editing:

    • Expression of nuclear-encoded, mitochondrially-targeted ND3 variants

    • Creation of heteroplasmic cells with mixed wild-type and modified mitochondrial populations

    • Import of synthetic mRNA or protein using mitochondrial targeting sequences

  • Developmental function studies:

    • Knockdown of factors required for mitochondrial translation of ND3

    • Creation of reporter constructs to monitor ND3 expression patterns during development

    • Inducible expression systems to control ND3 variant expression at specific developmental stages

  • Environmental adaptation analysis:

    • Introduction of ND3 variants to test hypotheses about adaptations to extreme environments

    • Competitive fitness assays between wild-type and modified strains under various conditions

While direct CRISPR editing of mitochondrial DNA remains challenging, emerging techniques like DddA-derived cytosine base editors (DdCBEs) specifically designed for mitochondrial DNA may soon enable precise modification of ND3 in its native context .

What are the potential applications of structural biology techniques like Cryo-EM in understanding the role of ND3 in Complex I assembly and function?

Cryo-electron microscopy (Cryo-EM) and related structural biology techniques offer transformative insights into ND3's role in Complex I:

  • High-resolution structure determination:

    • Visualization of A. franciscana Complex I at near-atomic resolution

    • Identification of unique structural features of ND3 compared to other species

    • Mapping of conformational changes during the catalytic cycle

  • Complex I assembly studies:

    • Structural characterization of assembly intermediates containing ND3

    • Identification of assembly factor binding sites on ND3

    • Visualization of conformational changes during incorporation into the complex

  • Functional mechanism investigations:

    • Structure determination in different functional states (active, deactive, inhibited)

    • Mapping of proton translocation pathways involving ND3

    • Identification of ubiquinone interaction sites

  • Comparative structural biology:

    • Structural comparison between A. franciscana ND3 and homologs from stress-sensitive species

    • Identification of structural adaptations that contribute to extreme condition tolerance

These approaches can reveal crucial mechanistic insights into how A. franciscana Complex I, particularly the ND3 component, contributes to the organism's exceptional physiological capabilities .

How might systems biology approaches integrate ND3 function into a broader understanding of Artemia franciscana metabolism under extreme conditions?

Systems biology approaches can contextualize ND3 function within the broader metabolic network of A. franciscana under extreme conditions:

  • Multi-omics integration:

    • Combine proteomics, transcriptomics, and metabolomics data to map changes in ND3 expression and function during stress responses

    • Identify regulatory networks controlling ND3 expression

    • Correlate ND3 activity with global metabolic shifts during anoxia

  • Flux balance analysis:

    • Develop constraint-based models of A. franciscana metabolism

    • Simulate the effects of altered ND3 function on metabolic flux distributions

    • Predict metabolic adaptations that compensate for changes in Complex I activity

  • Protein interaction networks:

    • Map interactions between ND3 and other proteins under normal and stress conditions

    • Identify stress-specific interaction partners that may modify ND3 function

    • Compare interaction networks across developmental stages

  • Comparative systems analysis:

    • Contrast system-level responses involving ND3 between A. franciscana and less stress-tolerant species

    • Identify unique regulatory mechanisms controlling respiratory chain function during anoxia

These integrative approaches can reveal how ND3 function is coordinated with broader metabolic reprogramming during the remarkable anoxic response of A. franciscana, potentially identifying novel principles of metabolic regulation under extreme conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.