Recombinant Artemia franciscana NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Artemia franciscana NADH-ubiquinone Oxidoreductase Chain 6 (ND6)

Recombinant Artemia franciscana NADH-ubiquinone oxidoreductase chain 6 (ND6) is a mitochondrial protein subunit of Complex I, a key enzyme in the electron transport chain responsible for transferring electrons from NADH to ubiquinone while pumping protons across the inner mitochondrial membrane . This recombinant version is produced via bacterial expression systems, typically in E. coli, and includes an N-terminal His-tag for purification .

Key Features

PropertyDescription
GeneND6 (mitochondrial-encoded)
Protein LengthFull-length (1–155 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Expression HostE. coli
Amino Acid SequenceMLGSIVVISMFMLLMNHPLAFTLSLFVQTLLICVMLKNVSLWISLILFLIFLGGILVMFI YVSSLSANEKFAVDLTSFMWVVPTIVLSFLVLNKNFMFMSPSSGYLYPTDFVIINFNVNS LTMLAYSFMVVYLFLALLLVIDFLNSNKKPLRSMI

Role in Mitochondrial Complex I

ND6 is a core subunit of Complex I, which is critical for ATP synthesis in aerobic organisms. In Artemia franciscana, this protein facilitates electron transfer and proton translocation, enabling the generation of the proton gradient required for oxidative phosphorylation .

Genetic and Sequence Features

  • Start Codon Variation: In Artemia persimilis, ND6 uses the rare TTG start codon, which is uncommon in mitochondrial genes .

  • Domain Architecture: ND6 contains conserved motifs associated with NADH dehydrogenase activity, including regions involved in quinone binding and proton pumping .

Production and Purification

The recombinant protein is synthesized in E. coli and purified via nickel-affinity chromatography due to its His-tag. Key production parameters include:

ParameterDetail
Expression SystemE. coli (optimized for high yield)
Purification MethodImmobilized metal affinity chromatography (IMAC)
ReconstitutionRecommended in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Genetic and Evolutionary Insights

  • Start Codon Evolution: The use of TTG in Artemia persimilis ND6 highlights non-canonical translation initiation mechanisms in mitochondrial genomes .

  • Population Variability: Mitochondrial DNA RFLP analyses in Artemia franciscana reveal haplotype diversity influenced by environmental selection pressures .

Challenges and Considerations

  • Protein Solubility: While high purity (>90%) is achievable, recombinant ND6 may require optimization for proper folding or activity assays.

  • Functional Studies: Limited direct data on recombinant ND6’s enzymatic activity exist, necessitating further biochemical characterization.

Future Directions

Research gaps include investigating ND6’s role in Artemia franciscana’s anoxia tolerance and its potential as a biomarker for mitochondrial dysfunction. Collaborative efforts integrating genetic, biochemical, and biotechnological approaches will advance our understanding of this protein’s function and applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ND6; ND-6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Artemia franciscana (Brine shrimp) (Artemia sanfranciscana)
Target Names
ND6
Target Protein Sequence
MLGSIVVISMFMLLMNHPLAFTLSLFVQTLLICVMLKNVSLWISLILFLIFLGGILVMFI YVSSLSANEKFAVDLTSFMWVVPTIVLSFLVLNKNFMFMSPSSGYLYPTDFVIINFNVNS LTMLAYSFMVVYLFLALLLVIDFLNSNKKPLRSMI
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 6 (ND6) and what is its function?

NADH-ubiquinone oxidoreductase chain 6 (ND6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Like other subunits such as ND2, it belongs to the minimal assembly required for catalysis within the electron transport chain. This protein functions primarily in the transfer of electrons from NADH to ubiquinone in the respiratory chain, contributing to the proton-translocating mechanism that ultimately drives ATP synthesis .

The ND6 gene in Artemia franciscana encodes a protein of 155 amino acids with a highly hydrophobic profile, consistent with its role as a membrane-embedded component of Complex I. The protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane where it participates in the electron transfer process .

How does ND6 compare to other mitochondrial genes in terms of genetic diversity?

Studies of mitochondrial genome diversity in Artemia species have revealed that ND6 exhibits a relatively high percentage of variable sites and nucleotide diversity compared to other protein-coding genes in the mitochondrial genome. This contrasts with genes like COX1 (cytochrome c oxidase subunit 1), which shows much higher conservation across Artemia species .

Specifically, comparative analyses have demonstrated that ND6, along with ATP8, displays significant variability among Artemia members. While COX1 has been identified as a highly conserved mitochondrial gene (with genetic distance as low as D = 0 between some lineages), ND6 shows considerably higher genetic distances between different Artemia species .

What expression systems are commonly used for recombinant ND6 production?

Escherichia coli is the primary expression system used for the production of recombinant Artemia franciscana ND6. This bacterial expression system offers several advantages for membrane protein production, including:

  • High yield of recombinant protein

  • Well-established protocols for induction and purification

  • Compatibility with N-terminal His-tagging for simplified purification

  • Cost-effectiveness and scalability

The commercial recombinant ND6 protein is expressed in E. coli with an N-terminal His-tag to facilitate purification and downstream applications .

How does the genetic variability of ND6 compare with other mitochondrial genes in evolutionary studies?

The comparative analysis of mitochondrial genes across Artemia species reveals that ND6 demonstrates distinctive evolutionary patterns. Research has shown that different mitochondrial genes provide varying levels of phylogenetic signal and exhibit different rates of molecular evolution.

ND6 shows relatively high genetic variability compared to more conserved genes like COX1 and COX2. In detailed studies of genetic distances between Artemia species, ND6 exhibited significant divergence patterns:

GeneCharacteristicObservation in Artemia
ND6VariabilityHigh percentage of variable sites
ND6Genetic distanceHigh between most species
COX1VariabilityLow percentage of variable sites
COX1Genetic distanceAs low as D = 0 between some lineages
ATP8VariabilityHighest among PCGs

This variability pattern makes ND6 potentially useful for studying recent evolutionary divergences within Artemia, while more conserved genes like COX1 may be better suited for deeper phylogenetic analyses .

What methodological approaches are recommended for amplifying and sequencing the ND6 gene?

For researchers seeking to amplify and sequence the ND6 gene from Artemia franciscana or related species, a PCR-based approach with gene-specific primers is recommended. Based on mitogenomic studies of Artemia, the following methodology can be applied:

  • Primer design: Design primers that target conserved regions flanking the ND6 gene. Consider the high variability of this gene when designing primers by targeting more conserved adjacent regions.

  • PCR optimization: Due to the membrane protein-coding nature and AT-richness of mitochondrial genes, optimization of PCR conditions is critical. Recommended parameters include:

    • Initial denaturation: 94°C for 5 minutes

    • 30-35 cycles of: 94°C for 30 seconds, 50-55°C for 45 seconds, 72°C for 1 minute

    • Final extension: 72°C for 10 minutes

  • Verification: Confirm amplification by gel electrophoresis, expecting a fragment of approximately 465-470 bp (for the 155 amino acid coding region plus primers).

  • Sequencing approach: Direct sequencing of PCR products or cloning into a suitable vector prior to sequencing is recommended depending on the research objectives .

What are the challenges in functional characterization of recombinant ND6?

Functional characterization of recombinant ND6 presents several significant challenges that researchers must address:

  • Membrane protein solubility: As a highly hydrophobic membrane protein, maintaining proper folding and solubility requires specialized approaches:

    • Use of appropriate detergents (e.g., n-dodecyl β-D-maltoside or digitonin)

    • Addition of phospholipids to stabilize the protein's native structure

    • Expression as fusion proteins with solubility-enhancing tags

  • Complex I assembly requirements: ND6 functions as part of the larger Complex I, making isolated functional studies challenging:

    • Consider reconstitution approaches with other Complex I subunits

    • Develop assays that can measure partial reactions relevant to ND6 function

    • Use model membrane systems like liposomes for functional studies

  • Oxidative damage during purification: The protein's role in electron transport makes it susceptible to oxidative damage:

    • Include reducing agents in purification buffers

    • Work under anoxic conditions when possible

    • Minimize exposure to light and elevated temperatures

  • Assaying activity: Direct measurement of ND6 activity is complicated by its integration into Complex I:

    • Monitor NADH:ubiquinone oxidoreductase activity in reconstituted systems

    • Use membrane potential-sensitive probes to assess proton translocation

    • Consider complementation assays in ND6-deficient systems

How can researchers interpret comparative data between ND6 and other mitochondrial genes?

Interpreting comparative data between ND6 and other mitochondrial genes requires careful consideration of several factors:

  • Differential evolutionary rates: ND6 exhibits higher variability compared to genes like COX1 and COX2. When analyzing phylogenetic relationships:

    • Account for rate heterogeneity between genes

    • Consider partitioned models in phylogenetic analyses

    • Assess saturation levels in highly variable regions

  • Functional constraints: Different genes are subject to different selective pressures based on their functions:

    • ND6 may show more variability in regions not directly involved in electron transport

    • Consider the protein's interaction sites with other Complex I subunits

    • Evaluate if observed variations affect conserved functional domains

  • Data integration approach: When comparing results from different mitochondrial genes:

    • Use complete mitogenome data when possible, as it provides more robust phylogenetic signal than individual genes

    • Weight gene contributions based on their evolutionary characteristics

    • Reconcile discordant gene trees through coalescent-based methods

  • Variable site analysis: When interpreting variable site percentages and nucleotide diversity:

    • Compare values within homologous regions across species

    • Normalize for gene length and base composition biases

    • Consider the functional impact of observed variations

What approaches can be used to study the interaction between ND6 and other subunits of Complex I?

Studying interactions between ND6 and other Complex I subunits requires sophisticated biochemical and structural approaches:

  • Crosslinking studies:

    • Use chemical crosslinkers with different spacer lengths to identify proximity relationships

    • Apply site-directed crosslinking by introducing cysteine residues at potential interaction sites

    • Analyze crosslinked products by mass spectrometry to identify interacting partners

  • Co-immunoprecipitation assays:

    • Generate antibodies against the His-tagged recombinant ND6

    • Perform co-IP experiments to identify stably associated proteins

    • Analyze pulled-down complexes by proteomics approaches

  • Structural biology approaches:

    • Cryo-electron microscopy of reconstituted subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Molecular dynamics simulations based on available structural data

  • Functional complementation:

    • Express wild-type or mutant ND6 in systems lacking this subunit

    • Assess restoration of Complex I activity and assembly

    • Monitor changes in electron transport and proton pumping efficiency

How does temperature affect the structure and function of recombinant ND6 in experimental settings?

Temperature has significant effects on both the structure and function of recombinant ND6 protein, which must be carefully considered in experimental design:

The importance of temperature is highlighted by studies showing rapid divergence between San Francisco Bay (SFB) and Vietnam (VC) Artemia populations at different temperatures (26°C and 30°C), suggesting adaptation to thermal environments that may affect mitochondrial proteins like ND6 .

What are recommended protocols for purification of recombinant His-tagged ND6?

Purification of recombinant His-tagged ND6 requires specialized protocols due to its hydrophobic nature:

  • Cell lysis and membrane preparation:

    • Harvest E. coli cells expressing His-tagged ND6 by centrifugation

    • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM PMSF, and protease inhibitor cocktail

    • Lyse cells using sonication or pressure-based methods

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Membrane protein solubilization:

    • Resuspend membrane pellet in solubilization buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 1% (w/v) n-dodecyl β-D-maltoside

    • Incubate with gentle agitation at 4°C for 1-2 hours

    • Remove insoluble material by ultracentrifugation at 100,000 × g for 30 minutes

  • Immobilized metal affinity chromatography (IMAC):

    • Load solubilized proteins onto Ni-NTA or similar resin pre-equilibrated with binding buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% detergent, 10 mM imidazole)

    • Wash extensively with binding buffer containing 20-30 mM imidazole

    • Elute His-tagged ND6 with elution buffer containing 250-300 mM imidazole

  • Buffer exchange and concentration:

    • Perform dialysis or use desalting columns to remove imidazole

    • Concentrate protein using 10 kDa MWCO concentrators

    • Store purified protein in buffer containing 0.05% detergent at -80°C in small aliquots

This protocol can typically yield 1-5 mg of purified recombinant ND6 protein per liter of E. coli culture .

How can researchers verify the functional integrity of purified recombinant ND6?

Verifying the functional integrity of purified recombinant ND6 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content expected for membrane proteins

    • Size exclusion chromatography to assess aggregation state

    • Limited proteolysis to evaluate proper folding (correctly folded proteins show distinctive proteolysis patterns)

  • Functional assays:

    • NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors

    • Reconstitution into liposomes and measurement of proton pumping using pH-sensitive probes

    • Binding assays with known interaction partners or inhibitors

  • Biophysical characterization:

    • Thermal shift assays to determine protein stability

    • Tryptophan fluorescence to monitor conformational changes upon substrate binding

    • Surface plasmon resonance to quantify interactions with other Complex I subunits

  • Complementation studies:

    • Introduction of purified recombinant ND6 into membrane preparations lacking this subunit

    • Assessing restoration of Complex I activity

    • Evaluating assembly of subcomplexes by blue native PAGE

How can ND6 genetic data be used in phylogenetic studies of Artemia species?

The ND6 gene provides valuable information for phylogenetic studies of Artemia species, though its application requires careful consideration:

  • Advantages of ND6 for phylogenetic studies:

    • Higher variability makes it suitable for resolving relationships between closely related species or populations

    • Provides complementary signal to more conserved genes like COX1

    • Maternal inheritance of mitochondrial genes allows tracking of maternal lineages

  • Recommended analytical approaches:

    • Use partitioned models that account for different evolutionary rates between genes

    • Employ maximum likelihood or Bayesian inference methods

    • Compare trees from individual genes versus concatenated datasets

    • Perform tests for saturation and long-branch attraction

  • Integration with complete mitogenomic data:

    • Complete mitogenomes provide more robust phylogenetic reconstructions than single genes

    • Use ND6 in combination with other genes for multi-gene analyses

    • Weight contribution based on evolutionary characteristics

Studies have shown that phylogenetic reconstructions based on complete mitogenomes provide more reliable results than those based on single mitochondrial markers, particularly for resolving relationships within the genus Artemia .

How do mutations in ND6 affect the function of Complex I, and what experimental approaches can detect these effects?

Mutations in ND6 can significantly impact Complex I function through various mechanisms, which can be detected through specialized experimental approaches:

  • Potential impacts of ND6 mutations:

    • Disruption of electron transfer pathways

    • Alteration of proton pumping efficiency

    • Destabilization of Complex I structure

    • Changes in interaction with other subunits

  • Experimental approaches to detect functional effects:

    • Site-directed mutagenesis to introduce specific mutations

    • Biochemical assays measuring NADH:ubiquinone oxidoreductase activity

    • Proton pumping measurements in reconstituted systems

    • Reactive oxygen species (ROS) production assessment

  • Structural analysis techniques:

    • Thermal stability measurements of mutant proteins

    • Cryo-EM structural analysis of assembled complexes with mutant subunits

    • Molecular dynamics simulations to predict structural perturbations

  • Cellular and organismal effects:

    • Expression of mutant ND6 in cell culture models

    • Assessment of mitochondrial membrane potential

    • Measurement of cellular ATP production

    • Oxygen consumption rate determination using respirometry

These approaches provide complementary information about how specific mutations affect both the biochemical properties of the protein and its function within the context of Complex I .

What are the future research directions for recombinant Artemia franciscana ND6?

Future research on recombinant Artemia franciscana ND6 presents several promising directions that build upon current knowledge and methodology:

  • Structural biology:

    • High-resolution structural determination of ND6 within the context of Complex I

    • Investigation of conformational changes during the catalytic cycle

    • Mapping of interaction sites with other Complex I subunits and membrane lipids

  • Evolutionary adaptations:

    • Comparative analysis of ND6 from Artemia populations adapted to different extreme environments

    • Investigation of temperature adaptations in ND6 structure and function

    • Correlation of genetic variations with functional properties across different species

  • Methodological advances:

    • Development of improved expression systems for membrane proteins

    • Creation of novel assays for measuring specific aspects of ND6 function

    • Application of advanced imaging techniques to visualize ND6 within the mitochondrial membrane

  • Integration with systems biology:

    • Understanding ND6 within the broader context of mitochondrial function

    • Investigation of nuclear-mitochondrial genetic interactions affecting ND6

    • Metabolic profiling of systems with modified ND6 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.