Recombinant Artemia salina Cytochrome c oxidase subunit 3 (COIII)

Shipped with Ice Packs
In Stock

Description

Artemia salina Biological Overview

Artemia salina, commonly known as brine shrimp, is a unique zooplankton that inhabits hypersaline environments worldwide. These organisms have gained prominence in both ecological research and laboratory settings due to their remarkable adaptability to extreme environmental conditions. The genus Artemia comprises both bisexual species and parthenogenetic populations with varying ploidy levels . Artemia's wide geographical distribution and unique lifecycle, which includes a dormant cyst stage capable of withstanding extreme conditions, make it an excellent model organism for various biological studies .

Mitochondrial Proteins in Artemia salina

Mitochondria in Artemia salina undergo significant morphological and biochemical changes during the transition from dormant cysts to actively metabolizing organisms. These organelles in dormant cysts are characterized by the absence of cristae and low respiratory capability . Upon hydration, mitochondrial biogenesis occurs in two distinct stages, leading to the development of functional respiratory machinery. This biogenesis involves significant changes in mitochondrial proteins, including cytochrome c oxidase components like COIII . The mitochondrial genome of Artemia has been extensively studied, with complete mitochondrial genome sequencing revealing the gene order and organization, including the position of the COIII gene adjacent to the tRNA Tyr gene .

Role of Cytochrome c oxidase in Cellular Respiration

Cytochrome c oxidase represents the terminal enzyme in the mitochondrial electron transport chain, catalyzing the reduction of molecular oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane. This complex comprises multiple subunits, with subunit 3 (COIII) playing a crucial structural and functional role. In Artemia salina, cytochrome c oxidase activity increases dramatically within the first hour of cyst hydration, marking the first stage of mitochondrial biogenesis . This rapid increase in cytochrome oxidase activity, along with changes in cytochrome b and cytochrome c, underscores the importance of these proteins in restoring respiratory capability during Artemia development.

Comparison with COIII from Other Species

Cytochrome c oxidase subunit 3 is highly conserved across species, reflecting its essential role in cellular respiration. The Artemia salina COIII sequence shows significant homology with corresponding sequences from other invertebrates and even vertebrates, although species-specific variations exist. These variations provide valuable insights for evolutionary studies and phylogenetic analyses.

Recombinant Expression in E. coli

The recombinant Artemia salina COIII protein is typically produced using E. coli expression systems, which provide efficient production of the target protein. The gene encoding COIII is cloned into appropriate expression vectors, often with an N-terminal His-tag to facilitate purification. The His-tagged fusion protein is expressed in E. coli under controlled conditions to optimize protein yield and solubility .

This recombinant approach offers several advantages over isolation from native sources, including higher yield, consistent quality, and the ability to introduce specific modifications like affinity tags. The expression conditions can be optimized to ensure proper folding and minimal aggregation of the recombinant protein.

Purification Techniques

Purification of the recombinant His-tagged COIII protein typically involves affinity chromatography using metal chelate resins. The His-tag binds specifically to metal ions like nickel or cobalt, allowing selective retention of the tagged protein while other cellular proteins are washed away. Additional purification steps may include size exclusion chromatography or ion-exchange chromatography to achieve high purity.

The purified protein is typically subjected to quality control assessments, including SDS-PAGE analysis to confirm size and purity, which should exceed 90% for commercial preparations .

Role in Mitochondrial Biogenesis

Cytochrome c oxidase subunit 3 plays a crucial role in the mitochondrial biogenesis that occurs during the development of Artemia salina cysts. Research has demonstrated that mitochondria in dormant cysts lack cristae and possess minimal respiratory capability . Upon hydration, a two-stage biogenesis process occurs, with the first stage characterized by a rapid increase in respiratory capability and cytochrome oxidase activity within just one hour .

The COIII protein contributes to this dramatic transformation, participating in the assembly of functional cytochrome c oxidase complexes that restore respiratory capability. This early increase in cytochrome oxidase activity is essential for supporting the metabolic demands of the developing organism as it emerges from dormancy.

Function in Respiratory Chain

As a component of cytochrome c oxidase, COIII contributes to the terminal step of the electron transport chain in mitochondria. This enzyme complex catalyzes the reduction of molecular oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane, generating the proton gradient necessary for ATP synthesis via oxidative phosphorylation.

While subunit 1 and subunit 2 of cytochrome c oxidase contain the catalytic core with metal centers involved in electron transfer, subunit 3 provides essential structural support and may participate in proton translocation pathways. The precise functional contribution of COIII to the catalytic activity of cytochrome c oxidase in Artemia salina remains an area of ongoing research.

Changes During Hydration of Artemia salina Cysts

The transition from dormant cysts to actively metabolizing nauplii in Artemia salina involves remarkable changes in mitochondrial structure and function. Research has shown that this process occurs in two distinct stages . The first stage, completed within one hour of hydration, involves a rapid increase in the respiratory capability of mitochondria, including elevated levels of cytochrome oxidase, cytochrome b, and cytochrome c, along with initial morphological changes .

The second stage is characterized by increased mitochondrial protein synthesis capacity and striking morphological transformations, including the formation of cristae . These changes support the metabolic requirements of the developing organism and highlight the dynamic nature of mitochondrial biogenesis during Artemia development.

Use in Toxicity Assessment Studies

Artemia salina has emerged as a valuable model organism for toxicity assessment of various compounds, including nanoparticles . The brine shrimp lethality test offers a rapid, convenient, and cost-effective alternative to cell culture-based cytotoxicity assays. Studies have demonstrated strong correlation between the results obtained from Artemia salina tests and MTT assays on cell lines, suggesting that the former can be a reliable predictor of cytotoxicity .

Recombinant proteins like COIII from Artemia salina can serve as molecular targets in mechanistic studies of toxicity, helping to elucidate how various compounds interact with essential cellular components. Understanding how toxicants affect the structure and function of critical proteins like cytochrome c oxidase can provide insights into mechanisms of toxicity at the molecular level.

Applications in Evolutionary and Phylogenetic Studies

The mitochondrial COI gene, which encodes part of the cytochrome c oxidase complex, has become a standard marker for species identification and phylogenetic analysis in many organisms, including Artemia . The development of specialized primers for amplifying the COI region in Artemia species has facilitated more reliable sequencing and phylogenetic analysis .

Recombinant COIII protein can serve as a reference standard in structural and functional comparisons across different Artemia species and populations. Such comparisons can provide insights into evolutionary relationships and adaptive changes in response to different environmental conditions.

The challenge of obtaining reliable COI sequences for certain Artemia populations, including Artemia aff. sinica, has led to innovative approaches in primer design. Researchers have developed primers that target the junction between tRNA Tyr and the beginning of the COI gene to ensure amplification of the authentic mitochondrial sequence rather than nuclear copies or pseudogenes .

Potential Biotechnological Applications

Beyond its applications in basic research, recombinant Artemia salina COIII protein has potential biotechnological applications. The protein's stability and well-defined structure make it suitable for use in protein engineering studies and as a model for designing novel biomolecules with specific functions.

Additionally, antibodies raised against recombinant COIII could serve as tools for monitoring mitochondrial development in various biological systems. Such antibodies could be valuable in studies of mitochondrial dysfunction in disease models or in assessing mitochondrial biogenesis in response to environmental challenges.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Artemia salina (Brine shrimp)
Target Names
COIII
Target Protein Sequence
LSALLNTSILLRSGVTVTWAHHALMENNFDQCLQGLLFTVLLGLYFSFLQGLEYMEASFT IADSIYGSTFFLATGFHGLHVLIGTIFLMICILRHLSATFSQHHFGFEAAAWYWH
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COIII) is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.