Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 1 (ND1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
ND1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1; Fragments
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Artemia salina (Brine shrimp)
Target Names
ND1
Target Protein Sequence
LAETNRTPFDLAEGECQVSVGFNTEYMHSSVGFALIMLSESEYASILFMSLFSVMFCLVV YSYLWSRGSYPRYRYDNLMHLCWKTSFTYIFNIPVFLLKPFSSGLKNKDPWLYNQPYSAF KTDALIGQGV
Uniprot No.

Target Background

Function

Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 1 (ND1): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly essential for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Artemia salina and why is it significant as a research model organism?

    Artemia salina (brine shrimp) is a primitive aquatic arthropod of the Artemiidae family that serves as a valuable model organism in scientific research. This organism possesses several characteristics that make it ideal for toxicological and biological studies:

    • Wide geographical distribution and remarkable adaptability to extreme environmental conditions

    • Ability to utilize multiple nutrient resources

    • Commercial availability of cysts for easy collection and storage

    • Rapid life cycle allowing for time-efficient experiments

    • Simple body structure facilitating observation of physiological changes

    Artemia salina has been used extensively in toxicology research for over three decades due to its convenient, economical, and straightforward application in bioassays. The brine shrimp lethality test requires minimal resources and produces results within 24 hours, making it an efficient preliminary screening tool for various compounds . Recent research has explored its potential as a surrogate test for dermonecrosis in mice, which aligns with the 3Rs philosophy (Replacement, Reduction, and Refinement) in animal testing .

  • How is the Artemia salina model applied in toxicological assessments?

    The Artemia salina bioassay has emerged as an effective alternative to more traditional toxicity testing methods. The methodology typically involves:

    1. Hatching Artemia cysts in artificial seawater (35g/L NaCl) under conditions of strong aeration and continuous illumination for 36-48 hours

    2. Collecting nauplii (larvae) that hatch within this timeframe

    3. Exposing nauplii to various concentrations of test compounds in a 96-well microtiter plate (typically 10 nauplii per well)

    4. Incubating at room temperature (28-30°C) for 24 hours

    5. Counting survivors under a stereoscopic microscope

    6. Calculating mortality percentages using Abbott's formula:

      % Lethality = [(Test deaths - Control deaths) ÷ (Total nauplii - Control deaths)] × 100

    This method has been validated against standard cell culture assays (MTT) with comparable results. A study comparing both methods found no statistically significant differences (P > 0.05) between LC50 values determined by the Artemia test and IC50 values from cell culture . This finding suggests that the Artemia test may expedite toxicity experiments and decrease costs while providing reliable results.

  • What is the genomic organization of ND1 in Artemia salina?

    The complete mitochondrial genome of Artemia salina was reported for the first time in 2021. The mitochondrial genome is 15,762 bp in length with a typical structure containing 13 protein-coding genes (PCGs), 22 transfer RNA genes (tRNAs), two ribosomal RNA genes, and a major non-coding region (CR) called the D-loop .

    Within this genome, the ND1 gene is one of the 13 protein-coding genes. It utilizes ATG as its start codon and has TAG as its stop codon. The base composition of the entire mitochondrial genome is 30.80% A, 17.49% C, 17.98% G, and 33.73% T, with a total A+T content of 64.53% .

    Phylogenetic analysis based on this genomic data indicated that Artemia salina has a closer relationship with A. persimilis compared to other Artemia species, providing valuable insights for population genetics and evolutionary studies .

Advanced Research Questions

  • How can researchers design experiments to evaluate the functional properties of recombinant Artemia salina ND1?

    Designing robust experiments to evaluate ND1 function requires a multi-faceted approach:

    1. Protein Expression and Purification Strategy:

      • Express recombinant protein in E. coli systems with an N-terminal His-tag for purification purposes

      • Optimize expression conditions (temperature, induction time, media composition)

      • Employ affinity chromatography for initial purification

      • Consider size exclusion chromatography for final polishing

      • Validate protein identity via mass spectrometry and western blotting

    2. Functional Assays:

      • Measure NADH oxidation rates spectrophotometrically at 340 nm

      • Assess ubiquinone reduction using appropriate analogs

      • Determine electron transfer kinetics under varying substrate concentrations

      • Evaluate the effects of inhibitors to confirm specificity

    3. Structural Characterization:

      • Perform circular dichroism spectroscopy to assess secondary structure

      • Consider X-ray crystallography or cryo-EM for detailed structural information

      • Conduct molecular dynamics simulations to predict functional domains

    4. Comparative Analysis:

      • Compare activity with orthologous proteins from related species

      • Evaluate the effects of site-directed mutagenesis on conserved residues

      • Assess function under varying pH, temperature, and salt conditions

    When setting up experimental controls, researchers should include both positive controls (commercially available complex I components) and negative controls (denatured protein or unrelated proteins) to validate assay specificity and sensitivity.

  • What methodological approaches are recommended for investigating the role of ND1 in the sodium-pumping mechanism of NADH:ubiquinone oxidoreductase?

    Investigating the role of ND1 in sodium-pumping NADH:ubiquinone oxidoreductase (Na+-NQR) requires specialized methodologies:

    1. Reconstitution in Liposomes:

      • Purify recombinant ND1 along with other Na+-NQR subunits

      • Reconstitute proteins in liposomes containing appropriate lipids

      • Load liposomes with sodium-sensitive fluorescent dyes

      • Monitor sodium transport using fluorescence spectroscopy during electron transfer

    2. Site-Directed Mutagenesis:

      • Identify conserved acidic residues potentially involved in sodium binding

      • Create alanine-substitution mutants of these residues

      • Assess the impact on sodium transport and electron transfer activities

      • Perform rescue experiments with chemically modified residues

    3. Isotope Flux Measurements:

      • Use 22Na+ to directly measure sodium transport rates

      • Establish inside-out membrane vesicles for controlled measurements

      • Correlate flux rates with electron transfer activity

    4. Electrophysiological Approaches:

      • Incorporate purified Na+-NQR complex into planar lipid bilayers

      • Measure ion currents under voltage-clamp conditions

      • Assess ion selectivity using bi-ionic potential measurements

    It's important to note that Na+-NQR evolved within the Chlorobi/Bacteroidetes group after duplication and neofunctionalization of the operon encoding the homologous RNF complex . Therefore, comparative studies with RNF complexes could provide valuable insights into the molecular mechanisms underlying sodium pumping.

  • How should researchers formulate effective research questions when studying novel aspects of recombinant Artemia salina ND1?

    Formulating effective research questions is crucial for directing investigations into novel aspects of recombinant Artemia salina ND1. Following the FINERMAPS criteria (Feasible, Interesting, Novel, Ethical, Relevant, Manageable, Appropriate, Potential value, Publishability, and Systematic) , researchers should:

    1. Begin with Subject Identification:

      • Start by identifying broader subjects of interest (e.g., "role of ND1 in energy metabolism")

      • Conduct preliminary research to understand existing knowledge gaps

      • Narrow the scope to specific aspects (e.g., "structural determinants of ND1 substrate specificity")

    2. Develop Question Types Based on Research Aims:

      • Existence questions: Does ND1 interact with specific lipids in the membrane?

      • Description and classification questions: What are the structural characteristics of functional domains in ND1?

      • Composition questions: What cofactors are associated with recombinant ND1?

      • Relationship questions: How does the redox state of ND1 correlate with proton translocation?

      • Comparative questions: How does the function of Artemia salina ND1 differ from mammalian homologs?

      • Causality questions: Does mutation of conserved residues in ND1 lead to altered electron transfer rates?

    3. Evaluate Questions Using Key Criteria:

      • Is the question clear and focused?

      • Is it complex enough to require both research and analysis?

      • Is it researchable within available time frames and resources?

      • Will it produce measurable data that can be supported or contradicted?

      • Is the scope appropriate (neither too broad nor too narrow)?

    4. Refine Through Iteration:

      • Write the question as completely as possible

      • Narrow to 2-3 key concepts

      • Specify the population, intervention, and outcome

      • Test the question with colleagues and revise accordingly

    For example, instead of asking "How does ND1 function?" (too broad), researchers might ask "How do specific conserved residues in the transmembrane domains of recombinant Artemia salina ND1 contribute to the efficiency of electron transfer from NADH to ubiquinone under varying pH conditions?"

  • What approaches can researchers use to compare ND1 function across different phylogenetic groups?

    Comparing ND1 function across phylogenetic groups requires systematic approaches that account for evolutionary differences while maintaining methodological consistency:

    1. Sequence-Based Comparative Analysis:

      • Perform multiple sequence alignments to identify conserved regions

      • Calculate evolutionary rates using models such as PAM or BLOSUM

      • Map conservation patterns onto structural models

      • Identify lineage-specific adaptations versus core functional elements

    2. Functional Comparison Methodologies:

      • Express recombinant ND1 proteins from different species under identical conditions

      • Standardize purification protocols to minimize methodology-induced variations

      • Assess electron transfer activities using identical substrate concentrations and assay conditions

      • Create a standardized activity score normalized to protein concentration

    3. Structure-Function Relationship Analysis:

      • Generate homology models for ND1 proteins from different species

      • Use molecular docking to predict substrate binding modes

      • Perform molecular dynamics simulations under identical force fields

      • Correlate structural differences with functional variations

    4. Heterologous Expression Studies:

      • Express ND1 from different species in a common host system

      • Create chimeric proteins with domains swapped between species

      • Assess functional complementation in knockout systems

    A comparative framework might be structured as follows:

    SpeciesSequence Identity (%)NADH Binding Affinity (K<sub>m</sub>)Electron Transfer Rate (μmol/min/mg)pH OptimumTemperature Optimum (°C)
    A. salina10015.2 ± 2.1423 ± 377.528
    A. persimilis9217.8 ± 2.4405 ± 427.326
    A. franciscana8922.3 ± 3.1378 ± 457.427
    Mammalian (Bos taurus)428.5 ± 1.2627 ± 587.237

    This systematic approach allows researchers to distinguish between functional adaptations related to environmental niches versus core mechanistic features conserved across evolutionary distances.

  • What methodologies are recommended for studying protein-protein interactions involving recombinant Artemia salina ND1?

    Investigating protein-protein interactions involving recombinant ND1 requires techniques that can capture both stable and transient interactions while maintaining native-like conditions:

    1. Co-immunoprecipitation with Tagged Proteins:

      • Express ND1 with an affinity tag (His-tag as described in product specifications )

      • Perform pull-down experiments using anti-tag antibodies

      • Identify co-precipitating proteins by mass spectrometry

      • Validate interactions using reciprocal pull-downs

    2. Crosslinking Mass Spectrometry (XL-MS):

      • Use membrane-permeable crosslinkers to stabilize interactions

      • Digest crosslinked complexes and identify crosslinked peptides by MS/MS

      • Map interaction interfaces based on crosslinked residues

      • Build structural models incorporating crosslinking constraints

    3. Fluorescence-based Interaction Assays:

      • Label ND1 and potential interaction partners with FRET-compatible fluorophores

      • Measure FRET efficiency as an indicator of protein proximity

      • Use fluorescence correlation spectroscopy to determine binding affinities

      • Perform fluorescence recovery after photobleaching (FRAP) to assess interaction dynamics

    4. Membrane-based Two-hybrid Systems:

      • Adapt split-ubiquitin or MYTH systems for membrane protein interactions

      • Generate fusion constructs with ND1 and potential interaction partners

      • Screen for interactions based on reporter gene activation

      • Validate positive hits using orthogonal methods

    5. Proximity Labeling Approaches:

      • Fuse ND1 to enzymes like BioID or APEX2

      • Allow biotinylation of proximal proteins in live cells

      • Purify biotinylated proteins and identify by mass spectrometry

      • Create interaction maps based on labeling patterns

    When interpreting results, researchers should consider that ND1 functions as part of multi-subunit complexes and its interactions may be dependent on membrane environments. Detergent selection is critical when working with membrane proteins like ND1, as inappropriate detergents can disrupt native interactions.

  • How can researchers address the challenges of data interpretation when studying ND1 function in different experimental systems?

    Data interpretation challenges when studying ND1 across different experimental systems require methodological approaches to ensure reproducibility and reliability:

    1. Standardization Protocols:

      • Develop standardized assay conditions (buffer composition, pH, temperature)

      • Use consistent protein quantification methods

      • Establish reference standards for activity measurements

      • Create detailed SOPs for all experimental procedures

    2. Statistical Approaches for Discrepancy Resolution:

      • Employ Bland-Altman plots to assess agreement between methods

      • Use mixed-effects models to account for inter-system variability

      • Apply Bayesian approaches to integrate prior knowledge with new data

      • Consider meta-analysis techniques when comparing across studies

    3. System-specific Calibration:

      • Develop correction factors based on known standards

      • Use control proteins with well-characterized behaviors across systems

      • Create normalization approaches specific to each system

    4. Triangulation of Results:

      • Employ multiple orthogonal methods to measure the same parameter

      • Prioritize agreement across different methodological approaches

      • Develop consensus values weighted by methodological reliability

    5. Controlling for System-specific Variables:

      • In cell-free systems: account for detergent effects and lipid composition

      • In heterologous expression: control for post-translational modifications

      • In native systems: consider the influence of endogenous proteins

    For example, when comparing toxicity data from Artemia assays with cell culture methods, researchers found correlation between the systems but with system-specific sensitivities. The table below shows comparative LC50/IC50 values, highlighting the importance of system-specific interpretation:

    NanoparticleArtemia salina assay LC<sub>50</sub> (μg/ml)95% Confidence LimitsMTT assay IC<sub>50</sub> (μg/ml)95% Confidence Limits
    Magnetic698.710431.764-2669.870997.402527.931-3340.601
    Nanosfer302.001215.853-497.009207.431141.862-365.065
    Liposome751.249432.851-6492.9551002.666543.931-4358.603
    Coated SLNs360.594285.519-501.000605.594472.900-1248.021
    Uncoated SLNs239.040192.979-310.917149.01890.886-328.486

    This data demonstrates that while there is general agreement in toxicity trends between systems, absolute values differ, necessitating system-specific interpretation frameworks .

  • How can researchers integrate studies of recombinant ND1 with broader investigations of Artemia salina as a model organism?

    Integrating ND1 studies with broader Artemia research requires a multi-level approach connecting molecular function to organismal phenotypes:

    1. Gene Expression Correlation Studies:

      • Profile ND1 expression across developmental stages (nauplii to adult)

      • Correlate expression levels with metabolic rates and activity patterns

      • Examine regulation under various environmental stressors

      • Develop stage-specific and tissue-specific expression maps

    2. Functional Genomics Approaches:

      • Develop RNAi or CRISPR methods to modulate ND1 expression in vivo

      • Assess phenotypic impacts of altered ND1 function

      • Correlate molecular alterations with physiological outcomes

      • Conduct transcriptomic analyses to identify compensatory mechanisms

    3. Metabolic Integration:

      • Measure oxygen consumption rates in intact organisms

      • Correlate with ND1 activity in isolated mitochondria

      • Perform metabolomic profiling to assess broader metabolic impacts

      • Develop flux balance models integrating ND1 function with metabolic networks

    4. Comparative Studies Across Artemia Species:

      • Compare ND1 sequences, structures, and functions across Artemia species

      • Correlate molecular differences with ecological niches

      • Assess functional conservation versus adaptation

      • Develop evolutionary models explaining observed patterns

    The complete mitochondrial genome analysis of Artemia salina revealed its closer phylogenetic relationship with A. persimilis compared to other Artemia species . This genomic context provides a framework for understanding ND1 evolution and adaptation that can be connected to broader ecological and physiological studies of these organisms.

    Researchers should also consider how ND1 function relates to the brine shrimp's remarkable adaptability to extreme environments, particularly its ability to survive in environments with variable oxygen levels and high salinity. The sodium-pumping function of related Na+-NQR complexes in bacteria suggests potential roles in ion homeostasis that may be relevant to Artemia's osmoregulatory capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.