Recombinant Arthrobacter aurescens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpB; AAur_2600; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Paenarthrobacter aurescens (strain TC1)
Target Names
atpB
Target Protein Sequence
MIALALPAQDSGSFTPPGIDEMHLPAILPWGAHDGFSKQMLLVILSVVIIATFFILAARK QQLVPGKLQFAGEMAYGFVRNGIAKDIIGGKDFIKYVPLLFSLFFFILVNNIYGAIPVIQ LPSFSHVGGAYVMAGIVYFTWIIIGIKKNGLKYFKLATVPSGVPWYILPIVVPIEIISNF LVRPVTHSLRLFATMLAGHLIVMLAGSGIEFLVMQENVLLKGASVLVLVGAVAMYMLEAL IMALQAYVFTLLTAIYIEGALHADSH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Arthrobacter aurescens?

ATP synthase subunit a (atpB) in Arthrobacter aurescens, like in other bacteria, is a crucial membrane-embedded component of the F0 region of ATP synthase. It works in conjunction with the c-ring to facilitate proton translocation across the membrane, which drives ATP synthesis. The subunit contains the proton channel and is essential for converting the proton motive force into rotational energy that powers ATP production . In bacterial ATP synthases like those found in Arthrobacter species, subunit a forms part of the simplest version of this molecular motor that produces ATP from ADP and inorganic phosphate using energy from a transmembrane proton gradient .

How does Arthrobacter aurescens ATP synthase differ structurally from other bacterial ATP synthases?

While the search results don't provide specific information about Arthrobacter aurescens ATP synthase structure, comparative analysis with other bacterial ATP synthases reveals key insights. Bacterial ATP synthases typically consist of F1 (catalytic) and F0 (membrane) regions. The Bacillus PS3 ATP synthase, which has been well-characterized through cryo-EM studies, shows how loops in subunit a of bacterial enzymes fulfill roles that require additional subunits in mitochondrial enzymes .

Unlike more complex eukaryotic ATP synthases, bacterial ATP synthases like those in Arthrobacter species generally have a simpler subunit composition but perform the same core functions. The peripheral stalk in bacterial ATP synthases is structurally simpler and more flexible than in eukaryotic counterparts, suggesting that bacterial subunits a and the c-ring are primarily held together by hydrophobic interactions rather than by the peripheral stalk .

What are the common challenges in expressing recombinant membrane proteins like ATP synthase subunit a?

Expressing recombinant membrane proteins, including ATP synthase subunit a, presents several significant challenges:

  • Hydrophobicity and folding: The highly hydrophobic nature of subunit a makes proper folding difficult in heterologous expression systems.

  • Toxicity to host cells: Overexpression of membrane proteins often disrupts host cell membrane integrity.

  • Protein solubility: Membrane proteins tend to aggregate or form inclusion bodies when overexpressed.

  • Post-translational modifications: Ensuring proper modifications that may be required for function.

  • Functional reconstitution: Membrane proteins often require specific lipid environments to maintain function.

Successful expression strategies often involve using specialized expression hosts (such as C41/C43 E. coli strains), fusion partners to increase solubility, and optimization of induction conditions . The successful expression of Bacillus PS3 ATP synthase in E. coli suggests that careful optimization of expression conditions can overcome these challenges for bacterial ATP synthase components .

What are the optimal expression systems for producing recombinant A. aurescens ATP synthase subunit a?

Based on successful approaches with other bacterial ATP synthases, the following expression systems would be most suitable for A. aurescens ATP synthase subunit a:

Expression SystemAdvantagesLimitationsKey Optimization Parameters
E. coli C41/C43 (DE3)Specialized for membrane proteins, reduced toxicityMay require codon optimizationTemperature (18-25°C), Induction (0.1-0.5 mM IPTG)
E. coli BL21(DE3) pLysSTight expression controlHigher likelihood of inclusion bodiesLow induction levels, growth at lower temperatures
Bacillus subtilisCloser phylogenetic relationship to A. aurescensMore complex transformationUse of native-like promoters

The Bacillus PS3 ATP synthase has been successfully expressed in E. coli, purified, and analyzed by cryo-EM, suggesting that E. coli-based systems can be effective for bacterial ATP synthase components . When expressing the complete ATP synthase complex, co-expression of all subunits may be necessary to achieve proper assembly, as demonstrated in the successful expression of Bacillus PS3 ATP synthase .

What purification strategies yield the highest purity and activity for recombinant atpB?

Purification of recombinant ATP synthase subunit a requires specialized approaches due to its membrane-embedded nature:

  • Membrane extraction: Use of detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin to solubilize the membrane protein while maintaining native conformation.

  • Affinity chromatography: Utilizing affinity tags (His6, FLAG, or Strep-tag II) positioned at termini least likely to interfere with folding and function.

  • Size exclusion chromatography: Critical for removing aggregates and ensuring homogeneity of the sample.

  • Ion exchange chromatography: Can provide additional purification based on the protein's charge characteristics.

For functional studies, reconstitution into proteoliposomes or nanodiscs maintains protein activity. The purification of intact ATP synthase from Bacillus PS3 involved extraction with appropriate detergents followed by chromatographic steps to achieve samples suitable for structural studies . Similar approaches could be applied to A. aurescens ATP synthase components.

How can researchers verify the proper folding and functionality of purified recombinant atpB?

Verification of proper folding and functionality requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure content to confirm proper folding.

  • Limited proteolysis: Properly folded proteins show resistance to proteolytic digestion compared to misfolded variants.

  • Functional reconstitution assays:

    • Reconstitution into liposomes and measurement of proton translocation

    • Assembly with other ATP synthase components to assess complex formation

    • ATP hydrolysis/synthesis assays when incorporated into the complete complex

  • Binding assays: Testing interaction with known binding partners using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC).

For ATP synthase subunit a, proper function is ultimately assessed by its ability to participate in proton translocation when incorporated into the complete ATP synthase complex .

What structural analysis methods are most effective for studying A. aurescens ATP synthase subunit a?

Several complementary structural analysis methods are particularly effective for studying membrane proteins like ATP synthase subunit a:

TechniqueResolutionAdvantagesChallengesSample Requirements
Cryo-EM2.5-4.0 ÅNative-like conditions, requires less sampleComplex data processing3-5 mg purified protein, high homogeneity
X-ray Crystallography1.5-3.0 ÅHigher resolution possibleCrystallization difficulties10+ mg protein, crystals
NMR SpectroscopyResidue-levelDynamic informationSize limitations15N/13C labeled protein
Hydrogen-Deuterium Exchange MSPeptide-levelConformational dynamicsLower resolution1-2 mg protein
Cross-linking Mass SpectrometryResidue-levelInteraction interfacesComplex data analysis1-2 mg protein

Cryo-EM has been particularly successful for analyzing bacterial ATP synthases, as demonstrated by the determination of Bacillus PS3 ATP synthase structures in three rotational states at resolutions of 3.0-3.2 Å . This technique allowed construction of nearly complete atomic models for the entire complex .

How do mutations in the atpB gene affect ATP synthase assembly and function?

Mutations in atpB can have diverse effects on ATP synthase assembly and function, depending on their location within the protein:

  • Proton channel residues: Mutations in conserved residues lining the proton channel (particularly conserved arginine residues) can completely abolish proton translocation without affecting assembly.

  • Interface residues: Mutations at the interface with the c-ring can disrupt the seal necessary for proton translocation efficiency or interfere with the rotational mechanism.

  • Folding-critical residues: Some mutations can prevent proper folding and membrane insertion, resulting in complete loss of assembly.

  • Peripheral residues: Mutations in regions that interact with other subunits might allow assembly but impair stability of the complete complex.

Studies on bacterial ATP synthases have shown that the architecture of the membrane region determines how the enzyme performs its core functions . The structures of Bacillus PS3 ATP synthase reveal the path of transmembrane proton translocation and provide a framework for understanding how specific residues in the enzyme contribute to function .

How can recombinant A. aurescens ATP synthase components be used to study inhibitor mechanisms?

Recombinant ATP synthase components offer powerful tools for studying inhibitor mechanisms:

  • Target identification: Purified recombinant subunits can be used in binding assays with potential inhibitors to identify specific interaction sites.

  • Structure-function studies: Site-directed mutagenesis of residues suspected to interact with inhibitors, followed by functional assays, can validate binding sites and mechanisms.

  • Comparative analysis: Comparing inhibitor sensitivity between ATP synthases from different species can reveal structural determinants of specificity.

  • In vitro reconstitution systems: Reconstituted systems containing recombinant components allow measurement of inhibitor effects on specific aspects of ATP synthase function, such as proton translocation or ATP synthesis.

Over 300 natural and synthetic ATP synthase inhibitors have been identified, each with reported inhibitory sites and suggested modes of action . A. aurescens ATP synthase components could be used to study how these inhibitors interact with bacterial ATP synthases compared to mitochondrial counterparts, potentially leading to the development of selective antibacterial agents.

What are the key differences in proton translocation mechanisms between A. aurescens ATP synthase and other bacterial species?

While specific information about A. aurescens ATP synthase is not provided in the search results, general principles of bacterial ATP synthase function can be inferred:

  • Conserved mechanism: The basic mechanism of proton translocation through subunit a and the c-ring is likely conserved across bacterial species, involving a proton path through half-channels in subunit a.

  • Species-specific adaptations: Differences may exist in:

    • The number of c-subunits in the ring (affecting the proton:ATP ratio)

    • Specific residues forming the proton path

    • Interactions between subunit a and the c-ring

    • Regulatory mechanisms

  • Environmental adaptations: A. aurescens, being a soil bacterium capable of growing on atrazine as a carbon and nitrogen source , may have adaptations in its ATP synthase for function under varying environmental conditions.

The structures of Bacillus PS3 ATP synthase provide insights into how bacterial ATP synthases function, revealing that loops in subunit a of bacterial enzymes fulfill roles that require additional subunits in more complex ATP synthases .

How does the genetic organization of ATP synthase genes in A. aurescens compare to other bacteria, and what are the evolutionary implications?

The genetic organization of ATP synthase genes can provide important evolutionary insights:

  • Operon structure: In most bacteria, ATP synthase genes are organized in an operon (atp operon), typically in the order atpIBEFHAGDC. Variations in this organization can reflect evolutionary adaptations.

  • Horizontal gene transfer: Comparison of gene sequences and organization can reveal potential horizontal gene transfer events, which are common in bacterial evolution.

  • Adaptation signatures: Selection pressures on ATP synthase genes can be identified through comparative genomic analysis, potentially revealing adaptations to specific environments.

While the search results don't provide specific information about A. aurescens ATP synthase gene organization, they do mention that A. aurescens TC1 contains genes related to atrazine metabolism (trzN, atzB, and atzC) that are linked on the genome but not organized in an operon-like structure . This suggests that A. aurescens may have acquired some metabolic capabilities through horizontal gene transfer, which could also have implications for the evolution of its energy production systems.

What methods can be used to measure proton translocation activity of reconstituted A. aurescens ATP synthase?

Several complementary methods can be used to measure proton translocation:

  • pH-sensitive fluorescent probes:

    • ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching

    • pyranine fluorescence for internal pH monitoring

    • These probes can detect changes in pH gradient across membranes

  • Membrane potential-sensitive dyes:

    • DiSC3(5) (3,3'-dipropylthiadicarbocyanine iodide)

    • Oxonol VI

    • These dyes measure the electrical component of the proton motive force

  • Direct proton flux measurements:

    • pH electrode-based measurements in lightly buffered solutions

    • Stopped-flow spectrophotometry with pH indicators

  • ATP synthesis/hydrolysis coupling:

    • Measurement of ATP synthesis driven by artificially imposed pH gradients

    • Determination of H+/ATP ratio

These methods can provide insights into how efficiently the reconstituted ATP synthase couples proton translocation to ATP synthesis or hydrolysis, similar to studies of proton translocation in other bacterial ATP synthases .

How does the inhibitory mechanism of subunit ε differ between A. aurescens ATP synthase and other bacterial ATP synthases?

Although specific information about A. aurescens ATP synthase inhibition is not provided in the search results, comparisons with other bacterial systems suggest:

The position of subunit ε in the Bacillus PS3 ATP synthase structures shows how it is able to inhibit ATP hydrolysis while allowing ATP synthesis . Similar mechanisms may exist in A. aurescens ATP synthase, possibly with adaptations related to its specific environmental niche.

What techniques can be used to study the coupling mechanism between the F0 and F1 regions in A. aurescens ATP synthase?

Understanding the coupling mechanism between F0 and F1 regions requires sophisticated techniques:

TechniqueInformation ObtainedAdvantagesLimitations
Single-molecule FRETReal-time conformational changesDirect observation of coupling eventsRequires strategic labeling
High-speed AFMVisualization of rotational dynamicsLabel-free, near-native conditionsLower resolution than cryo-EM
Cryo-EM of different rotational statesStatic snapshots of rotation cycleHigh structural detailNo dynamic information
Site-directed mutagenesis combined with functional assaysCritical residues for couplingDirect testing of mechanistic hypothesesIndirect evidence
Crosslinking of rotor-stator interfacesIdentification of transient interactionsCaptures specific statesMay perturb native function

The structures of Bacillus PS3 ATP synthase in three rotational states provide insights into the coupling mechanism, showing that the C-terminal water-soluble part of subunit b displays significant conformational variability between states, while the subunits in the F1 region show little flexibility beyond the catalytic states of the αβ pairs .

How can recombinant A. aurescens ATP synthase be used as a model system for studying bacterial bioenergetics?

Recombinant A. aurescens ATP synthase offers several advantages as a model system:

  • Metabolic versatility context: A. aurescens can metabolize various compounds, including atrazine, as sole carbon and nitrogen sources , providing a context for studying how ATP synthase function integrates with diverse metabolic pathways.

  • Environmental adaptation: As a soil bacterium, A. aurescens faces varying environmental conditions, making its ATP synthase potentially interesting for studying adaptations to changing energy availability.

  • Comparative studies: Comparing A. aurescens ATP synthase with well-characterized systems like those from E. coli or Bacillus PS3 can reveal both conserved mechanisms and species-specific adaptations.

  • Genetic tractability: The ability to express bacterial ATP synthases in heterologous hosts, as demonstrated with Bacillus PS3 ATP synthase in E. coli , facilitates genetic manipulation for structure-function studies.

Research on the electric field within ATP synthase suggests exceptional enzymatic efficiency, with calculations revealing that alterations in the electric field support proton movement and ATP formation . Such studies could be extended to A. aurescens ATP synthase to understand how bacterial ATP synthases achieve their remarkable efficiency rate of approximately 90% .

What insights can A. aurescens ATP synthase provide into the evolution of bacterial bioenergetic systems?

A. aurescens ATP synthase could provide several evolutionary insights:

  • Adaptation to soil environments: Analysis could reveal adaptations specific to soil bacteria, which face fluctuating nutrient and oxygen availability.

  • Relationship to metabolic capabilities: A. aurescens can metabolize atrazine and other s-triazine compounds , and studying its ATP synthase could reveal how energy conservation systems co-evolved with specialized metabolic pathways.

  • Horizontal gene transfer signatures: Given that A. aurescens TC1 appears to have acquired atrazine degradation genes through horizontal gene transfer , analysis of its ATP synthase genes could reveal whether components of its bioenergetic systems were similarly acquired.

  • Minimal functional requirements: The simplicity of bacterial ATP synthases compared to their mitochondrial counterparts shows how core functions can be performed with a minimal set of components . A. aurescens ATP synthase could provide additional insights into these minimal requirements.

How do the kinetic parameters of A. aurescens ATP synthase compare to those from other bacterial species?

A comparative analysis of kinetic parameters would involve:

ParameterTypical Range in BacteriaFactors Affecting ValuesMeasurement Methods
ATP synthesis rate50-500 ATP/s per enzymeTemperature, pH, PMF magnitudeLuciferase assay, NADH-coupled assays
ATP hydrolysis rate20-200 ATP/s per enzymeTemperature, inhibitory state of subunit εPi release assays, coupled enzyme assays
Km for ATP0.2-2.0 mMSpecies, temperature, membrane environmentStandard enzyme kinetics
Km for ADP0.05-0.5 mMSpecies, regulatory stateStandard enzyme kinetics
H+/ATP ratio3-4 in bacteriac-ring stoichiometrypH jump experiments, ATP synthesis yield
Proton conductanceSpecies-dependentSubunit a structure, c-ring interfaceMembrane potential decay, pH gradient dissipation

While specific kinetic data for A. aurescens ATP synthase is not provided in the search results, bacterial ATP synthases generally operate with high efficiency. Recent studies on the electric field within ATP synthase suggest that it has exceptional enzymatic efficiency, with an estimated efficiency rate of approximately 90% . The potential difference between proton entry and exit enhances the electrochemical gradient of the inner membrane, offsetting the energy required to dissipate the proton selection and modifying the free energy of proton translocation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.