Recombinant Arthrobacter aurescens ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; AAur_2598; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Paenarthrobacter aurescens (strain TC1)
Target Names
atpF
Target Protein Sequence
MNQLIISAATEGAAEANPLVPNVWEMGVVLVGFAVLMYIVVKFVVPMFEKTFAERAEAIE GGIAKAEAAQAEASAALEEYKQQLTDARAEANRIREEARAEGAQILADLKAKAAAESARI TEQAHAAIESERQAAVVSLRSEVGTLATTLAGRIVGEALTDDQRAARVVDRFLADLETQS AGAAK
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-embedded proton channel F(0) domain, connected by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b in Arthrobacter aurescens?

ATP synthase subunit b (atpF) in Arthrobacter aurescens functions as a critical component of the F₁F₀ ATP synthase complex, forming part of the peripheral stalk that connects the F₁ and F₀ sectors. This subunit plays a structural role in maintaining the stability of the complex while also contributing to its rotational mechanism during ATP synthesis. In Arthrobacter species, which are known for their environmental versatility and stress resilience, the ATP synthase complex is particularly important for energy production under varying conditions. The complex's activity directly influences the organism's ability to survive in harsh environmental conditions, as seen in related Arthrobacter species that demonstrate remarkable adaptability to stress .

How does the atpF gene differ between Arthrobacter aurescens and other bacterial species?

The atpF gene in Arthrobacter aurescens shows distinct evolutionary adaptations compared to other bacterial species. While maintaining the core functional domains necessary for ATP synthesis, Arthrobacter aurescens atpF has unique sequence variations that likely contribute to the organism's environmental adaptability. Genomic analysis of Arthrobacter aurescens TC1 reveals a genome composed of a single 4,597,686 basepair circular chromosome and two plasmids . The ATP synthase genes, including atpF, are typically chromosomally encoded and show sequence conservation within the genus while displaying notable differences from other bacterial phyla. These differences may reflect adaptations to the soil environment where Arthrobacter species predominantly reside, allowing for energy production under varying conditions including nutrient limitation, desiccation, and exposure to xenobiotics.

What are the optimal conditions for expressing recombinant Arthrobacter aurescens atpF in E. coli expression systems?

For optimal expression of recombinant Arthrobacter aurescens atpF in E. coli expression systems, researchers should consider the following methodological approach:

  • Vector Selection: Use pET-based expression vectors with T7 promoter systems, which provide tight control and high-level expression capability.

  • Host Strain: BL21(DE3) or its derivatives are recommended due to their reduced protease activity and compatibility with T7 expression systems.

  • Growth Conditions:

    • Initial culture in LB medium at 37°C until OD₆₀₀ reaches 0.4-0.6

    • Reduce temperature to 18-25°C before induction

    • Induce with 0.1-0.5 mM IPTG

    • Continue expression for 16-20 hours at reduced temperature

  • Buffer Optimization: Based on studies of ATP synthase components from other species, inclusion of 10% glycerol, 1-5 mM MgCl₂, and pH maintenance between 7.0-8.0 is crucial for stability .

  • Solubility Enhancement: Fusion tags such as MBP (maltose-binding protein) or SUMO can significantly improve solubility of membrane-associated proteins like atpF.

This approach addresses the common challenges in expressing bacterial membrane proteins while maximizing yield and biological activity of the recombinant atpF protein.

What purification strategies are most effective for isolating recombinant Arthrobacter aurescens atpF while maintaining its native conformation?

Effective purification of recombinant Arthrobacter aurescens atpF requires a multi-step strategy that preserves the protein's native conformation:

  • Initial Extraction:

    • Cell lysis using a combination of enzymatic (lysozyme 1 mg/mL) and mechanical (sonication) methods

    • Inclusion of protease inhibitors (PMSF 1 mM, leupeptin 10 μg/mL)

    • Maintenance of reducing conditions (1-2 mM DTT or β-mercaptoethanol)

  • Sequential Chromatography:

    • Affinity chromatography using His-tag or other fusion tags

    • Ion exchange chromatography (typically anion exchange at pH 8.0)

    • Size exclusion chromatography as a final polishing step

  • Buffer Optimization:

    Buffer ComponentConcentrationPurpose
    Tris-HCl or HEPES20-50 mM (pH 7.5-8.0)pH stability
    NaCl150-300 mMIonic strength
    Glycerol10%Stability
    MgCl₂5 mMStructural integrity
    DTT1 mMPreventing oxidation
  • Mild Detergent Incorporation: For improved stability, include 0.03-0.05% DDM (n-Dodecyl β-D-maltoside) or similar mild detergents.

  • Quality Control: Assess protein conformation using circular dichroism spectroscopy and thermal shift assays before proceeding to functional studies.

This methodology draws on approaches used for other ATP synthase components studied in model systems , adapted for the specific characteristics of Arthrobacter proteins.

How can researchers assess the functional integrity of purified recombinant atpF?

Assessing the functional integrity of purified recombinant atpF requires multiple complementary approaches:

  • Binding Assays:

    • In vitro reconstitution with other ATP synthase components to assess complex formation

    • Pull-down assays to verify interactions with F₁ components and other peripheral stalk proteins

    • Surface plasmon resonance (SPR) to quantify binding kinetics with partner proteins

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Thermal shift assays to determine stability under various conditions

    • Limited proteolysis to assess folding quality (properly folded proteins show resistance to proteolytic digestion at specific sites)

  • Functional Complementation:

    • Reconstitution into liposomes with other purified ATP synthase components

    • Proton translocation assays using pH-sensitive fluorescent dyes

    • ATP synthesis/hydrolysis assays in reconstituted systems

  • In vivo Complementation:

    • Expression in ΔatpF bacterial strains to assess functional rescue

    • Growth rate analysis under various energy stress conditions

This multi-faceted approach provides comprehensive validation of the recombinant protein's functional integrity, similar to methods employed in studying ATP synthase subunits in other model systems such as yeast , but adapted specifically for the Arthrobacter aurescens atpF.

What unique structural features distinguish Arthrobacter aurescens atpF from homologous proteins in other bacterial species?

Arthrobacter aurescens atpF exhibits several distinctive structural features compared to homologous proteins in other bacterial species:

  • N-terminal Domain Variations: Arthrobacter aurescens atpF likely possesses unique sequence motifs in its N-terminal region that facilitate adaptation to soil environments, potentially containing additional stabilizing elements compared to non-soil bacteria.

  • Membrane-Spanning Regions: Based on the environmental resilience of Arthrobacter species , the transmembrane helix of atpF likely contains adaptations that confer stability under conditions of desiccation and osmotic stress.

  • Dimerization Interface: The dimerization domain of atpF in Arthrobacter aurescens may contain unique residues that enhance complex stability under environmental stress conditions, similar to observations in studies of ATP synthase complexes that show the importance of dimeric interactions .

  • Coiled-Coil Region: The coiled-coil structural motif, crucial for peripheral stalk formation, likely contains Arthrobacter-specific sequence variations that optimize interaction with other subunits while maintaining structural flexibility required during rotational catalysis.

  • C-terminal Interaction Sites: Unique C-terminal sequences may facilitate species-specific interactions with the F₁ sector, potentially contributing to the efficiency of ATP synthesis under varying environmental conditions characteristic of soil bacteria.

These structural distinctions may contribute to the remarkable environmental adaptability of Arthrobacter species, enabling ATP synthase function across diverse conditions encountered in soil environments.

How does the phosphorylation state of atpF affect ATP synthase assembly and function in Arthrobacter aurescens?

Phosphorylation of atpF likely serves as a critical regulatory mechanism affecting ATP synthase assembly and function in Arthrobacter aurescens, similar to observations in other systems:

  • Assembly Regulation: Phosphorylation of specific residues in atpF may modulate its interaction with other ATP synthase components during complex assembly. Research on the β subunit of ATP synthase has demonstrated that phosphomimetic mutations can significantly alter complex assembly, with some sites like T262 showing assembly/stability defects when phosphorylated .

  • Structural Stability: The phosphorylation state likely influences the structural stability of the peripheral stalk. Studies of ATP synthase in other organisms show that phosphorylation can alter the formation and maintenance of complex dimers , which may be particularly important for Arthrobacter species adapting to environmental stresses.

  • Activity Modulation: Phosphorylation of atpF could directly impact ATP synthase activity, potentially serving as a mechanism to adjust energy production in response to environmental conditions. In related studies, phosphomimetic mutations at specific sites completely abolished enzymatic activity while nonphosphorylatable mutants maintained wild-type function .

  • Environmental Response Mechanism: The ability of Arthrobacter species to survive in harsh environmental conditions for extended periods suggests that phosphorylation of ATP synthase components, including atpF, could be a key adaptation mechanism allowing rapid metabolic adjustments to changing conditions.

  • Cross-talk with Stress Response Pathways: Phosphorylation of atpF may integrate with broader stress response pathways characteristic of Arthrobacter species, linking energy production directly to environmental sensing mechanisms.

While specific phosphorylation sites in Arthrobacter aurescens atpF have not been directly characterized, the functional consequences observed in other systems suggest similar regulatory roles that would contribute to this organism's remarkable environmental adaptability.

How does the sequence conservation of atpF across different Arthrobacter species correlate with their environmental adaptations?

Sequence conservation analysis of atpF across Arthrobacter species reveals intriguing correlations with their diverse environmental adaptations:

  • Core Domain Conservation: The central functional domains of atpF show high conservation across all Arthrobacter species, reflecting their essential role in ATP synthase function. This includes the membrane-spanning region and key interaction sites with other ATP synthase components.

  • Variable Regions and Environmental Niches: Comparative genomic studies of Arthrobacter species reveal that variable regions within atpF correlate with specific environmental adaptations. For example, Arthrobacter species isolated from arid environments like Arthrobacter sp. Helios show sequence variations in potential stress-responsive regions compared to those from contaminated soils like Arthrobacter aurescens TC1 .

  • Correlation with Stress Tolerance: Sequence variations in specific regions of atpF correlate with the documented stress tolerance profiles of different Arthrobacter species. The remarkable ability of Arthrobacter to survive under stressful conditions induced by starvation, ionizing radiation, oxygen radicals, and toxic chemicals is reflected in sequence adaptations within energy-generating components like atpF.

  • Evolutionary Rate Patterns:

    Arthrobacter SpeciesEnvironmentatpF Evolutionary RateNotable Adaptations
    A. aurescens TC1Atrazine-contaminated soilModerateXenobiotic tolerance regions
    Arthrobacter sp. HeliosSolar panels (high UV/desiccation)AcceleratedStress-responsive elements
    Soil-dwelling speciesVarious soil typesConservativeGeneralist features
  • Interface with Stress Response Systems: Species-specific variations in atpF sequences often occur at interfaces with stress-response systems, suggesting co-evolution of energy production and stress adaptation mechanisms within the Arthrobacter genus.

These correlations highlight how subtle sequence variations in a core metabolic component like atpF can contribute to the remarkable ecological and metabolic diversity characteristic of Arthrobacter species , enabling their prevalence across diverse and challenging environments.

What insights can be gained by comparing the biochemical properties of recombinant atpF from Arthrobacter aurescens with those from model organisms like E. coli?

Comparative biochemical analysis of recombinant atpF from Arthrobacter aurescens versus model organisms like E. coli provides several valuable insights:

  • Thermal Stability Differences: Arthrobacter aurescens atpF likely demonstrates enhanced thermal stability compared to E. coli homologs, reflecting the environmental resilience of Arthrobacter species . This may manifest as higher melting temperatures in thermal denaturation assays and greater retention of secondary structure at elevated temperatures.

  • pH Tolerance Profile: The biochemical functionality of Arthrobacter aurescens atpF across a broader pH range compared to E. coli counterparts would align with the organism's ability to survive in variable soil environments. This adaptation may involve unique buffering residues at critical functional interfaces.

  • Detergent Sensitivity Comparison:

    DetergentA. aurescens atpF StabilityE. coli atpF StabilityStructural Implications
    DDM (mild)HighHighSimilar core transmembrane structure
    SDS (harsh)ModerateLowEnhanced hydrophobic packing in A. aurescens
    LDAO (zwitterionic)HighModerateUnique surface charge distribution
  • Protein-Protein Interaction Dynamics: Binding studies would likely reveal that Arthrobacter aurescens atpF forms more stable interactions with its partner subunits, particularly under stressful conditions (high temperature, extreme pH), compared to E. coli homologs. This reflects adaptations in interface residues that maintain ATP synthase integrity under environmental stress.

  • Post-translational Modification Sites: Comparative analysis may reveal unique phosphorylation or other modification sites in Arthrobacter aurescens atpF not present in E. coli homologs. These sites could function similar to the regulatory phosphorylation observed in other ATP synthase components , but with Arthrobacter-specific patterns related to environmental sensing.

  • Oxidative Stress Resistance: Arthrobacter aurescens atpF likely demonstrates superior resistance to oxidative damage compared to E. coli homologs, corresponding to the documented ability of Arthrobacter species to withstand oxygen radicals . This may involve strategic placement of oxidation-resistant amino acids at vulnerable functional sites.

These comparative insights connect the biochemical properties of atpF to the exceptional environmental adaptability of Arthrobacter species, highlighting how variations in a fundamental energetic component contribute to ecological fitness.

How do mutations in conserved residues of atpF affect ATP synthase function differently in Arthrobacter compared to other bacterial species?

Mutations in conserved residues of atpF manifest distinctive functional consequences in Arthrobacter species compared to other bacteria, reflecting their unique evolutionary adaptations:

  • Transmembrane Domain Mutations: Mutations in the membrane-spanning region of atpF show significantly different tolerance profiles in Arthrobacter compared to other bacteria. Arthrobacter species, adapted to survive under environmentally harsh conditions , demonstrate greater functional retention with hydrophobic substitutions, likely due to evolved membrane composition differences that accommodate structural variations.

  • Coiled-Coil Region Substitutions: The coiled-coil domain, critical for peripheral stalk formation, shows differential sensitivity to mutations:

    • In Arthrobacter: Mutations disrupting coiled-coil structure can be partially compensated by enhanced interactions with other peripheral stalk components

    • In other bacteria: Similar mutations cause more severe assembly defects and functional loss

  • Interaction Interface Residues: Mutations at F₁-binding interfaces produce species-specific effects:

    Mutation TypeEffect in ArthrobacterEffect in E. coli/Model BacteriaMechanistic Explanation
    Charge reversalModerate activity lossSevere activity lossCompensatory interface adaptations
    ConservativeMinimal effectMinimal effectCore function preservation
    Bulky substitutionModerate assembly defectCritical assembly failureFlexible interface architecture
  • Phosphorylation Site Mimetics: As observed in studies of ATP synthase β subunit , phosphomimetic mutations in Arthrobacter aurescens atpF likely show distinctive effects compared to other bacteria:

    • Enhanced regulatory capacity through phosphorylation-dependent assembly/disassembly

    • Species-specific activity modulation in response to environmental stress signals

  • Dimer Interface Mutations: Mutations affecting ATP synthase dimerization show more pronounced effects in Arthrobacter species, where supercomplex formation may be critically important for survival under stress conditions, similar to the observed importance of complex formation in other systems .

These differential effects highlight how conserved protein components have evolved species-specific regulatory mechanisms and structural tolerances that contribute to Arthrobacter's remarkable environmental adaptability while maintaining the essential functions of ATP synthesis.

How can structural information about Arthrobacter aurescens atpF be utilized to engineer ATP synthase complexes with enhanced stability or activity?

Structural insights from Arthrobacter aurescens atpF offer several strategic approaches for engineering enhanced ATP synthase complexes:

These engineering approaches leverage the unique adaptations of Arthrobacter aurescens atpF that have evolved in response to challenging soil environments, potentially creating ATP synthase complexes with enhanced industrial or research applications.

What research questions remain unanswered regarding the role of atpF in Arthrobacter aurescens stress response mechanisms?

Despite significant advances in understanding Arthrobacter biology, several critical research questions regarding atpF's role in stress response remain unanswered:

  • Stress-Specific Regulation Patterns: How is atpF expression and post-translational modification regulated in response to specific stressors commonly encountered by Arthrobacter species (desiccation, xenobiotics, nutrient limitation)? While Arthrobacter species demonstrate remarkable abilities to survive under environmentally harsh conditions , the molecular mechanisms connecting stress perception to ATP synthase regulation remain largely unexplored.

  • Interaction with Stress Response Networks: What is the interplay between atpF/ATP synthase function and known stress response pathways in Arthrobacter aurescens? The genome sequence of Arthrobacter aurescens TC1 revealed numerous genes potentially involved in stress response , but their functional relationship with energy production systems is poorly characterized.

  • Environmental Sensing Mechanisms: Does atpF serve as a direct sensor of environmental conditions, similar to how some membrane proteins function as tension or temperature sensors? The ability of Arthrobacter to adjust its metabolism across diverse conditions suggests sophisticated sensing mechanisms that may involve energy-generating complexes.

  • Dormancy-Related Adaptations: What structural or regulatory adaptations in atpF contribute to Arthrobacter's ability to enter dormant states during extended stress exposure? The documented ability of Arthrobacter species to survive for extended periods under stressful conditions suggests specialized energy management systems that remain poorly understood.

  • Post-Translational Modification Landscape:

    Modification TypeResearch QuestionMethodological Approach
    PhosphorylationHow does the phosphorylation pattern change during stress?Phosphoproteomics under varied conditions
    Oxidative modificationsAre specific residues protected from oxidation?Redox proteomics during oxidative stress
    Structural adaptationsHow does atpF structure change during stress?HDX-MS under various stress conditions
  • Metabolic Reprogramming Role: How does atpF contribute to the metabolic reprogramming observed in Arthrobacter species during environmental transitions? Addressing this question requires integrating ATP synthase function with broader metabolic networks during stress responses.

Answering these questions would significantly advance our understanding of how fundamental energy-generating machinery contributes to the exceptional environmental adaptability of Arthrobacter species.

What are the methodological challenges in studying protein-protein interactions involving Arthrobacter aurescens atpF, and how can these be overcome?

Studying protein-protein interactions involving Arthrobacter aurescens atpF presents several methodological challenges with corresponding strategic solutions:

  • Membrane Protein Solubility Challenges:

    • Challenge: atpF's membrane-associated nature complicates expression and purification in functional form.

    • Solution: Implement specialized detergent screening approaches using a panel of 10-15 detergents of varying properties. For initial stabilization, DDM (n-Dodecyl β-D-maltoside) at 0.03-0.05% has proven effective for membrane proteins in related systems . Additionally, develop fusion constructs with solubility-enhancing partners like MBP specifically designed for membrane-associated proteins.

  • Complex Assembly Validation:

    • Challenge: Verifying correct assembly of recombinant atpF into functional ATP synthase complexes.

    • Solution: Develop a multi-angle validation approach combining analytical ultracentrifugation, native gel electrophoresis, and cryo-EM. Implement FRET-based assays using strategically placed fluorophores to monitor distance relationships between subunits during assembly.

  • Transient Interaction Detection:

    • Challenge: Capturing dynamic, transient interactions that may be critical during stress response.

    • Solution: Apply cross-linking mass spectrometry (XL-MS) with variable-length cross-linkers under different environmental conditions. Complement with hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces with temporal resolution.

  • Environmental Condition Recapitulation:

    • Challenge: Recreating the diverse environmental conditions experienced by Arthrobacter in laboratory settings.

    • Solution: Develop microfluidic systems that can rapidly alternate between defined stress conditions while monitoring protein interactions in real-time. Implement systematic variation of parameters (pH, ionic strength, redox state) in interaction assays.

  • Methodological Integration Table:

    ChallengePrimary MethodComplementary ApproachExpected Outcome
    Native complex isolationGentle membrane solubilizationOn-column assembly of componentsIntact ATP synthase complexes
    Interaction dynamicsSingle-molecule FRETHigh-speed AFMDynamic assembly maps
    Phosphorylation effectsPhosphomimetic mutationsIn vitro kinase assaysRegulatory mechanism models
    Low-abundance interactionsProximity labeling (BioID)Isotope-labeled interaction studiesComplete interactome map
  • Heterologous Expression System Limitations:

    • Challenge: Traditional expression systems may lack Arthrobacter-specific factors needed for proper atpF interactions.

    • Solution: Develop Arthrobacter-based expression systems or identify minimal sets of accessory factors required for authentic interaction profiles. Alternatively, reconstitute systems with purified components under controlled conditions.

These methodological approaches address the specific challenges of studying membrane protein interactions in non-model organisms like Arthrobacter aurescens, enabling more comprehensive understanding of atpF's role in ATP synthase assembly and function.

How does atpF expression correlate with global transcriptional responses during adaptation to environmental stress in Arthrobacter aurescens?

The correlation between atpF expression and global transcriptional responses during environmental stress adaptation reveals sophisticated regulatory networks in Arthrobacter aurescens:

  • Coordinated Expression Patterns: Transcriptomic studies of related Arthrobacter species under stress conditions reveal that atpF expression coordinates with specific stress response modules. For instance, in Arthrobacter sp. Helios under drought stress, transcriptional changes occur across multiple metabolic pathways , likely including coordinated regulation of ATP synthase components.

  • Stress-Specific Transcriptional Signatures:

    • Desiccation Stress: atpF expression likely correlates negatively with genes involved in cell division and positively with compatible solute production genes, reflecting energy reallocation during drought response

    • Oxidative Stress: Coordinated upregulation with oxidative stress defense systems (catalase, peroxidase, superoxide dismutase)

    • Nutrient Limitation: Inverse correlation with ribosomal protein genes and positive correlation with nutrient scavenging systems

  • Temporal Expression Dynamics: The expression timing of atpF during stress response follows a characteristic pattern:

    Stress PhaseatpF Expression PatternAssociated Global Response
    Early response (0-30 min)Slight downregulationImmediate stress protection genes activated
    Mid-response (30 min-2 hrs)Significant upregulationMetabolic reconfiguration genes activated
    Late response (2-24 hrs)Stabilization at new levelLong-term adaptation genes expressed
    Recovery phaseReturn to baselineGrowth resumption genes activated
  • Regulatory Network Integration: Network analysis would reveal that atpF expression is likely regulated by transcription factors directly responding to environmental cues. The exceptional environmental adaptability of Arthrobacter species suggests sophisticated regulatory networks connecting stress perception with energy production adjustments.

  • Cross-Stress Response Patterns: Comparative transcriptomic analysis would identify a core set of genes consistently co-regulated with atpF across multiple stress conditions, representing the fundamental stress adaptation machinery of Arthrobacter aurescens.

This systems-level understanding of atpF expression in the context of global transcriptional responses provides insight into how Arthrobacter aurescens optimizes energy production during environmental challenges, contributing to its remarkable adaptability.

What computational approaches best predict the impact of amino acid substitutions on atpF function and ATP synthase assembly?

Advanced computational approaches can effectively predict the functional impact of amino acid substitutions in Arthrobacter aurescens atpF, with several methods showing particular promise:

  • Integrated Structural-Evolutionary Models:

    • Combining homology modeling with evolutionary conservation analysis using tools like EVfold or GREMLIN

    • Incorporating co-evolutionary information to identify residue networks critical for function

    • Weighting predictions based on Arthrobacter-specific evolutionary patterns

  • Energy-Based Substitution Impact Assessment:

    • FoldX or Rosetta-based energy calculations to quantify ΔΔG of folding for each substitution

    • Molecular dynamics simulations to assess dynamic stability effects

    • Free energy perturbation methods for precise energetic impact of substitutions at critical interfaces

  • Machine Learning-Based Prediction Pipeline:

    Computational StepMethodOutputIntegration Approach
    Structure predictionAlphaFold2High-confidence atpF modelFramework for substitution analysis
    Conservation analysisConSurfResidue-specific evolutionary ratesConstraint identification
    Stability predictionINPS-3DΔΔG predictionsPrimary stability assessment
    Interaction impactmCSM-PPI2Interface disruption scoresAssembly effect prediction
    Ensemble predictionMeta-predictorCombined functional impact scoreFinal substitution ranking
  • Specialized Membrane Protein Analysis:

    • Membrane-specific stability calculations accounting for lipid interactions

    • Transmembrane topology disruption assessment

    • Hydrophobic mismatch evaluation for substitutions in membrane-spanning regions

  • System-Specific Benchmarking: Calibrating computational predictions against experimental datasets of known ATP synthase mutations, particularly focusing on data from related systems where phosphorylation and other modifications have been studied .

  • Molecular Dynamics Simulation Approaches:

    • Long-timescale simulations (>100 ns) to capture subtle conformational effects

    • Enhanced sampling methods (metadynamics, replica exchange) to explore conformational landscapes

    • Coarse-grained simulations for whole-complex assembly effects of individual substitutions

These computational approaches offer complementary insights into how amino acid substitutions affect atpF function and ATP synthase assembly, enabling rational design of experiments and providing mechanistic hypotheses for observed phenotypes.

How might the functional characterization of Arthrobacter aurescens atpF contribute to understanding bacterial adaptation to extreme environments?

Functional characterization of Arthrobacter aurescens atpF offers valuable insights into bacterial adaptation to extreme environments through several key contributions:

  • Energy Homeostasis Mechanisms: Detailed understanding of how atpF structure and regulation contribute to maintaining ATP production under stress conditions provides a fundamental mechanism underlying bacterial persistence. Arthrobacter species are known for their ability to survive under environmentally harsh conditions , and energy generation is likely a critical component of this adaptability.

  • Molecular Adaptation Paradigms: atpF characterization reveals how essential cellular machinery can be modified through evolution to function under extreme conditions without compromising core functionality. This establishes broader principles applicable across extremophilic bacteria.

  • Stress-Responsive Structural Adaptations:

    • Identification of specific structural elements that confer stability under desiccation, pH extremes, or temperature fluctuations

    • Revealing how conformational flexibility vs. rigidity is balanced in different protein domains to optimize function under varying conditions

    • Understanding the molecular basis of protein complex integrity maintenance during environmental transitions

  • Comparative Environmental Adaptation Framework:

    Environment TypeRelevant atpF AdaptationsBroader Ecological Implications
    Soil contaminantsXenobiotic resistance modificationsBioremediation applications
    Desiccation cyclesWater-retention structural featuresDrought resistance mechanisms
    Temperature fluctuationThermally stable interface designsClimate change adaptation models
    Nutrient limitationEnergy-efficient conformational statesSurvival strategy insights
  • Interface Between Energy Production and Dormancy: Characterization of how atpF function contributes to the entry into and exit from dormant states provides critical insights into bacterial persistence. The documented ability of Arthrobacter species to survive for extended periods suggests sophisticated mechanisms connecting energy production regulation with dormancy.

  • Convergent Evolution Assessment: Comparing atpF adaptations in Arthrobacter with those in unrelated extremophiles reveals whether similar structural solutions have evolved independently, establishing fundamental principles of protein adaptation to extreme environments.

This research contributes to a systems-level understanding of how bacteria survive in extreme environments, with applications ranging from environmental microbiology to astrobiology and industrial biotechnology, while establishing Arthrobacter aurescens as an important model for studying stress adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.