Recombinant Arthrobacter aurescens Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Reaction

Undecaprenyl-diphosphatase (EC 3.6.1.27) catalyzes the hydrolysis of undecaprenyl diphosphate (C55-PP) to undecaprenyl phosphate (C55-P), releasing inorganic phosphate :
C55-PP+H2OC55-P+Pi\text{C55-PP} + \text{H}_2\text{O} \rightarrow \text{C55-P} + \text{P}_i

This reaction is essential for recycling the lipid carrier undecaprenyl phosphate, which transports peptidoglycan precursors across the cytoplasmic membrane in bacteria . The enzyme’s activity is enhanced by divalent cations like Ca²⁺ .

Biological Role and Significance

  • Peptidoglycan Biosynthesis: UppP is indispensable for cell wall synthesis, enabling the regeneration of undecaprenyl phosphate for lipid-linked precursor cycling .

  • Antibiotic Resistance: UppP confers resistance to bacitracin by preventing antibiotic-induced sequestration of C55-PP .

  • Metabolic Versatility: A. aurescens TC1, the source organism, is renowned for degrading diverse xenobiotics (e.g., atrazine) and heavy metals, reflecting its genomic adaptability .

A. Antibiotic Studies

  • UppP depletion in Bacillus subtilis increases susceptibility to β-lactams but enhances resistance to fosfomycin and D-cycloserine, highlighting its role in lipid carrier homeostasis .

  • In B. subtilis, UppP interacts with the SigM stress-response regulon to maintain undecaprenyl phosphate pools under antibiotic stress .

B. Biotechnological Relevance

  • Recombinant UppP is commercially available (e.g., Cusabio, Creative Biomart) for studying cell wall biosynthesis and antibiotic resistance mechanisms .

  • A. aurescens TC1’s genome reveals horizontal gene transfer events and metabolic adaptations, making it a model for studying enzyme evolution .

Industrial and Environmental Implications

  • Bioremediation: A. aurescens TC1’s genomic plasticity, including plasmid-borne catabolic genes, underscores its utility in degrading pollutants like atrazine .

  • Drug Development: UppP inhibitors are explored as novel antibiotics, though partial inhibition may inadvertently select for resistance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
uppP; AAur_2168; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Paenarthrobacter aurescens (strain TC1)
Target Names
uppP
Target Protein Sequence
MNWIEAALLGLVQGLTEFLPISSSAHLRIVGSFLPNAADPGAAFTAITQLGTETAVIVYF WRDIVRIVQAWFGSLTGKVERNNPDARMGWLVILGSLPIIVLGLLFQDQIESVLRSMWIV ATMLIVFGMILAVADAVGRQERDLTQLSYKHGILYGFAQAMALIPGVSRSGGTITAGLLM GYTREAAARYSFLLAIPAVFGSGLYQLYKTVSNEGLAGPYGLPETALATVIAFVVGYVII GWFLKFVSTRSYRLFVWYRILLGLALYVLLGFNVISA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (UppP) and what is its biological function?

Undecaprenyl pyrophosphate phosphatase (UppP), also known as BacA in some bacterial species, is an integral membrane protein that plays a critical role in bacterial cell wall synthesis. UppP catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP or UPP) to undecaprenyl phosphate (C55-P or UP), which serves as an essential carrier lipid in peptidoglycan biosynthesis . This reaction is crucial because undecaprenyl phosphate functions as a carrier for precursors across the bacterial membrane during cell wall synthesis, and the recycling of this carrier is essential for bacterial survival. In Arthrobacter aurescens, as in other bacteria, UppP is involved in both de novo synthesis and recycling pathways of the carrier lipid .

How is UppP involved in bacterial antibiotic resistance?

UppP has been implicated in resistance to bacitracin, an antibiotic that specifically targets the cell wall synthesis pathway. Bacitracin binds to undecaprenyl pyrophosphate (UPP) and prevents its dephosphorylation, thereby inhibiting peptidoglycan synthesis and bacterial growth. When UppP is overexpressed, it increases the conversion rate of UPP to UP, effectively reducing the target availability for bacitracin and conferring resistance to the antibiotic .

Studies in Enterococcus faecalis have shown that UppP mutants exhibit significantly increased susceptibility to bacitracin (MICs=3-6 mg/L) compared to wild-type strains (MICs=32-48 mg/L). Conversely, when uppP was overexpressed, bacitracin resistance increased dramatically (MICs=128-≥256 mg/L) . This mechanism is likely conserved in Arthrobacter aurescens and other bacterial species with similar UppP enzymes.

What are the key structural features of bacterial UppP enzymes?

UppP is a highly hydrophobic integral membrane protein with a predicted structure of eight transmembrane helices. Sequence alignment studies have identified two consensus regions critical for function:

  • An (E/Q)XXXE motif typically located in the first transmembrane helix

  • A PGXSRSXXT motif that resembles a P-loop structure

  • A conserved histidine residue (His-30 in E. coli UppP) positioned in proximity to the active site

These structural elements create an active site pocket that is oriented toward the periplasmic side of the bacterial membrane, suggesting that the enzyme's biological function occurs on the outer side of the plasma membrane . The table below summarizes key residues identified in the E. coli UppP enzyme that are likely conserved in Arthrobacter aurescens:

ResidueMotifFunctionEffect of Mutation
Glu-17(E/Q)XXXEInteracts with pyrophosphate via Mg²⁺E17A: 5-fold decrease in kcat, 4-5-fold increase in Km
Glu-21(E/Q)XXXEInteracts with pyrophosphate via Mg²⁺E21A: 5-fold decrease in kcat
His-30Conserved HisProximity to pyrophosphateH30A: Severely impaired activity
Ser-173PGXSRSXXTP-loop structureS173A: Complete inactivation
Arg-174PGXSRSXXTH-bond with OH of pyrophosphateR174A: Complete inactivation
Thr-178PGXSRSXXTP-loop structureT178A: Complete inactivation

What are the optimal expression systems for recombinant Arthrobacter aurescens UppP?

Recombinant expression of UppP presents significant challenges due to its highly hydrophobic nature with eight transmembrane domains. Based on successful approaches with E. coli UppP, the following expression systems are recommended for Arthrobacter aurescens UppP:

  • E. coli-based expression systems:

    • E. coli C41(DE3) strain, which is specifically designed for membrane protein expression

    • Use of pET-based vectors with T7 promoter systems for controlled expression

    • Fusion tags to enhance protein folding and solubility

  • Fusion tag strategies:

    • N-terminal bacteriorhodopsin fusion has been particularly successful for E. coli UppP, increasing expression and maintaining protein activity

    • His-tag for purification purposes, optimally positioned at the N-terminus

    • MBP (maltose-binding protein) fusion can sometimes improve membrane protein solubility

Expression should be induced at OD600 of approximately 0.9 with 0.5 mM IPTG. For bacteriorhodopsin fusions, supplementation with 5-10 mM all-trans-retinal during induction is recommended. Induction should proceed for 5 hours at 37°C, though lower temperatures (16-25°C) with extended induction times (overnight) may improve proper folding for some constructs .

How can I optimize the purification of recombinant Arthrobacter aurescens UppP?

Purification of UppP requires specific approaches due to its membrane-bound nature:

  • Membrane isolation:

    • Harvest cells and resuspend in appropriate buffer (e.g., 50 mM Tris pH 7.5, 500 mM NaCl)

    • Disrupt cells using a cell disruption system or sonication

    • Collect membranes by ultracentrifugation at approximately 40,000 rpm for 1.5 hours

  • Solubilization:

    • Solubilize membrane pellet using mild detergents

    • Recommended detergents: n-dodecyl-β-D-maltopyranoside (DDM) at 1% (w/v) or n-dodecylphosphocholine (DPC)

    • Incubate with gentle agitation at 4°C for at least 1 hour

  • Chromatography steps:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography to remove aggregates and detergent micelles

    • Maintain 0.02-0.05% detergent in all purification buffers to prevent protein aggregation

  • Buffer optimization:

    • Final buffer composition: 50 mM Hepes (pH 7.0), 150 mM NaCl, 0.02% DDM

    • Addition of 10 mM MgCl₂ or CaCl₂ is critical for maintaining enzyme activity

Purified protein should be stored at -80°C in small aliquots to prevent freeze-thaw cycles. Addition of 10% glycerol to storage buffer may help maintain protein stability.

What are the established methods for measuring UppP enzyme activity?

Several methodologies can be employed to assess the activity of purified recombinant Arthrobacter aurescens UppP:

  • Phosphate colorimetric assay:

    • The most commonly used method that measures the release of inorganic phosphate

    • Standard reaction mixture: 50 mM Hepes (pH 7.0), 150 mM NaCl, 10 mM MgCl₂, 0.02% DDM, substrate (typically 35 μM Fpp as a model substrate), and purified UppP (20-40 nM)

    • Reactions are incubated at 37°C and quenched by adding Malachite Green reagent

    • Released phosphate is measured at 650 nm and quantified using a phosphate standard curve

  • Radiometric assay:

    • Using radiolabeled substrate (³²P-labeled UPP)

    • More sensitive but requires special handling due to radioactivity

    • Enables detection of very low activity levels

  • Coupled enzyme assay:

    • Linking phosphate release to NADH oxidation via purine nucleoside phosphorylase and xanthine oxidase

    • Allows continuous monitoring of activity

    • Useful for kinetic studies and inhibitor screening

The table below outlines the optimal reaction conditions for UppP activity assays:

ParameterOptimal ConditionNotes
pH7.0 (Hepes buffer)Activity range spans pH 6.5-8.0
Temperature37°CReflects physiological conditions
Divalent cations10 mM Mg²⁺ or Ca²⁺Absolute requirement for activity
Detergent0.02% DDMCritical for protein stability
Substrate concentration0.3-57 μM FppFor kinetic parameter determination
Protein concentration20-40 nMAdjusted based on specific activity

How do substrate specificity and kinetic parameters of UppP vary across bacterial species?

While specific kinetic data for Arthrobacter aurescens UppP may not be directly available, comparisons can be made based on studies of UppP from other bacterial species:

  • Substrate preference:

    • Natural substrate: Undecaprenyl pyrophosphate (UPP, C55-PP)

    • Model substrate: Farnesyl pyrophosphate (Fpp) is commonly used due to its greater solubility and commercial availability

    • Other accepted substrates may include geranyl pyrophosphate and shorter isoprenoid pyrophosphates

  • Kinetic parameters comparison:
    Based on studies with E. coli UppP, typical parameters include:

    ParameterWild-type UppPE17A MutantE21A MutantH30A Mutant
    Km (μM)4-818-224-8-
    kcat (s⁻¹)15-203-43-4<0.1
    kcat/Km (μM⁻¹s⁻¹)2-50.15-0.20.4-0.5-
  • Species variations:

    • Substrate binding affinity (Km) and catalytic efficiency (kcat/Km) can vary by 2-10 fold between bacterial species

    • These differences are often correlated with membrane composition and cell wall structure

    • Conservation of catalytic residues suggests similar mechanisms across species

When studying Arthrobacter aurescens UppP, researchers should first establish baseline kinetic parameters using standard assay conditions, then explore how these parameters compare to other bacterial UppP enzymes.

How do specific mutations in the active site affect UppP catalytic function?

Structure-function studies of UppP have identified critical residues within the conserved motifs that are essential for enzymatic activity. Mutagenesis studies in E. coli UppP provide valuable insights that likely apply to Arthrobacter aurescens UppP as well:

  • (E/Q)XXXE motif residues:

    • Glu-17: E17A mutation causes a 5-fold decrease in kcat and 4-5-fold increase in Km for Fpp, suggesting this residue is critical for both substrate binding and catalysis

    • Glu-21: E21A mutation results in a 5-fold decrease in kcat without significant change in Km, indicating its primary role in catalysis rather than binding

    • Double mutation E17A/E21A completely eliminates enzyme activity, demonstrating the essential nature of these residues

  • Conserved histidine residue:

    • His-30: H30A mutation severely impairs enzyme activity, suggesting a crucial role in substrate positioning or direct participation in catalysis

    • Computational modeling suggests His-30 is positioned in close proximity to the pyrophosphate moiety of the substrate

  • PGXSRSXXT motif (P-loop structure):

    • Ser-173: S173A mutation completely inactivates the enzyme

    • Arg-174: R174A mutation abolishes activity; modeling suggests this residue forms a hydrogen bond with the hydroxyl group of the pyrophosphate moiety

    • Thr-178: T178A mutation results in complete inactivation

These mutagenesis results can be summarized in the activity profile below:

ResidueMutationResidual Activity (%)Effect on Substrate BindingEffect on Catalysis
Glu-17E17A20-25%Significantly reducedModerately reduced
Glu-21E21A20-25%Minimal effectSignificantly reduced
Glu-17/Glu-21E17A/E21A<1%AbolishedAbolished
His-30H30A<5%Not determinedSeverely reduced
Ser-173S173A<1%Not determinedAbolished
Arg-174R174A<1%AbolishedAbolished
Thr-178T178A<1%Not determinedAbolished

When designing mutations in Arthrobacter aurescens UppP, researchers should focus on these key residues to explore structure-function relationships.

What structural models exist for UppP and how reliable are they for predicting enzyme-substrate interactions?

In the absence of a crystal structure for UppP from any bacterial species, computational modeling approaches have been employed to predict its three-dimensional structure and substrate interactions:

  • Modeling approaches:

    • Rosetta membrane ab initio modeling has been used successfully for E. coli UppP

    • Homology modeling with distantly related phosphatases can provide partial structural insights

    • Molecular dynamics (MD) simulations can validate and refine initial models

  • Key features of UppP structural models:

    • Eight transmembrane helices arranged to form a substrate-binding pocket

    • Active site located near the periplasmic face of the membrane

    • Conserved residues from both motifs spatially arranged to interact with the pyrophosphate moiety

    • Magnesium coordination site formed by acidic residues (Glu-17, Glu-21)

  • Reliability assessment:

    • Model validation through site-directed mutagenesis has shown good correlation between predicted structural features and experimental results

    • MD simulations demonstrate stability of the predicted structure in a membrane environment

    • The models successfully explain the requirement for divalent cations in enzyme activity

For Arthrobacter aurescens UppP, researchers should consider:

  • Generating new models based on sequence alignment with E. coli UppP

  • Validating models through selected mutations of conserved residues

  • Using complementary biophysical techniques (e.g., cross-linking, FRET) to test structural predictions

How does UppP function in the context of the bacterial cell wall synthesis pathway?

Understanding UppP in the broader context of bacterial cell wall synthesis provides important insights for its study:

  • Dual pathway involvement:

    • UppP participates in both de novo synthesis and recycling pathways of undecaprenyl phosphate

    • In E. coli, UppP accounts for approximately 75% of the total cellular C55-PP phosphatase activity, with other enzymes (PgpB, YbjG, and LpxT) contributing the remaining 25%

  • Spatial organization:

    • Topological studies suggest that the UppP active site faces the periplasm, contradicting earlier hypotheses that it operates on the cytoplasmic side

    • This periplasmic orientation aligns UppP with other phosphatases involved in the recycling pathway

    • The spatial organization has implications for how inhibitors or activators might access the enzyme

  • Coordination with other enzymes:

    • UppP function must be coordinated with upstream enzymes like undecaprenyl pyrophosphate synthase (UppS)

    • Downstream processes including MraY and peptidoglycan glycosyltransferases depend on UppP activity

    • This suggests potential regulatory mechanisms or protein-protein interactions

A simplified schematic of the C55 carrier lipid cycle is presented below:

PathwayStepEnzymeLocationProduct
De novo synthesis1UppSCytoplasmC55-PP
2UppPPeriplasmC55-P
Peptidoglycan synthesis3MraYCytoplasmLipid I
4MurGCytoplasmLipid II
5PG TransglycosylasesPeriplasmPeptidoglycan + C55-PP
Recycling6UppP, PgpB, YbjGPeriplasmC55-P

In Arthrobacter aurescens, researchers should investigate whether similar enzymatic redundancy exists and how UppP integrates into the specific cell wall synthesis machinery of this organism.

What are the challenges in developing specific inhibitors of UppP and how might they be overcome?

Developing specific inhibitors of UppP presents several challenges but also opportunities for antimicrobial development:

  • Structural challenges:

    • Lack of high-resolution crystal structures hampers structure-based drug design

    • Membrane-embedded nature of the enzyme complicates inhibitor accessibility

    • Active site may be partially shielded by lipid bilayer components

  • Selectivity concerns:

    • Need to distinguish between bacterial UppP and mammalian phosphatases

    • Challenge of achieving selectivity among various bacterial species

    • Multiple phosphatases with overlapping functions in many bacteria

  • Potential strategies:

    • Focus on unique structural features identified in computational models

    • Target the interface between enzyme and membrane rather than just the active site

    • Develop lipophilic compounds capable of accessing the membrane-embedded active site

    • Consider dual-target inhibitors affecting both UppP and other enzymes in the pathway

  • Methodological approaches:

    • High-throughput screening using the phosphate release assay

    • Fragment-based drug discovery focusing on the pyrophosphate binding site

    • Peptidomimetic approaches based on known inhibitors like bacitracin

    • Computational docking studies using refined UppP models

The table below outlines compound classes with potential for UppP inhibition:

Compound ClassPotential Binding SiteAdvantagesChallenges
Pyrophosphate analogsActive siteDirect competitionPoor membrane permeability
Lipophilic acidsActive site + membrane interfaceGood accessibilityPotential off-target effects
Cationic peptidesSubstrate binding groovePrecedent (bacitracin)Stability and bioavailability
Metal chelatorsMg²⁺/Ca²⁺ binding siteExploits metal dependenceSpecificity concerns

How can I resolve common issues in recombinant UppP expression and purification?

Researchers working with recombinant Arthrobacter aurescens UppP may encounter several technical challenges. Here are solutions to common problems:

  • Low expression levels:

    • Problem: Membrane proteins often express poorly in standard systems

    • Solutions:

      • Try lower induction temperatures (16-20°C) with extended expression times

      • Test different fusion tags (MBP, bacteriorhodopsin, SUMO)

      • Consider specialized E. coli strains (C41, C43, Lemo21)

      • Optimize codon usage for E. coli expression

  • Protein aggregation during purification:

    • Problem: UppP tends to aggregate due to its hydrophobic nature

    • Solutions:

      • Screen multiple detergents (DDM, DPC, LDAO, DMNG)

      • Increase detergent concentration during solubilization (1-2%)

      • Maintain at least 0.02% detergent in all buffers

      • Add glycerol (10%) to stabilize the protein

      • Consider including lipids (E. coli polar lipids) during purification

  • Low enzymatic activity:

    • Problem: Purified protein shows little or no activity

    • Solutions:

      • Ensure presence of divalent cations (10 mM Mg²⁺ or Ca²⁺) in assay buffer

      • Verify pH optimum (typically pH 7.0)

      • Check for inhibitory contaminants from purification

      • Try reconstituting protein in liposomes to restore native-like environment

      • Use freshly purified enzyme as activity may decrease during storage

What strategies can overcome the challenges in conducting structure-function studies of UppP?

Structure-function studies of membrane proteins like UppP present unique challenges that require specific approaches:

  • Limitations in structural studies:

    • Challenges in obtaining protein crystals for X-ray crystallography

    • Size limitations for NMR studies of intact membrane proteins

    • Potential artifacts from detergent solubilization

  • Alternative structural approaches:

    • Cryo-electron microscopy (cryo-EM) for larger constructs or UppP complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe solvent accessibility

    • Site-directed spin labeling combined with EPR spectroscopy

    • Cross-linking mass spectrometry to identify spatial relationships between residues

    • Local environment probes using engineered cysteine residues and thiol-reactive dyes

  • Functional analysis strategies:

    • Alanine-scanning mutagenesis of conserved residues

    • Conservative substitutions to probe specific chemical properties (e.g., E→D, K→R)

    • Chimeric proteins between different bacterial UppPs to identify species-specific regions

    • In vivo complementation studies using UppP-deficient bacterial strains

  • Computational approaches:

    • Molecular dynamics simulations in explicit membrane environments

    • Quantum mechanics/molecular mechanics (QM/MM) studies of the reaction mechanism

    • Evolutionary coupling analysis to identify co-evolving residues

    • Pharmacophore modeling for potential inhibitor design

The combination of these approaches can provide comprehensive insights into UppP structure and function despite the challenges posed by its membrane-embedded nature.

What are the emerging techniques and approaches for studying UppP enzymes across bacterial species?

Research on bacterial UppPs is evolving rapidly with several emerging techniques offering new opportunities:

  • Advanced structural biology approaches:

    • Single-particle cryo-EM for membrane proteins without crystallization

    • Lipid cubic phase crystallization specifically designed for membrane proteins

    • Integrative structural biology combining multiple low-resolution techniques

    • Nanodiscs and amphipols as alternatives to detergents for stabilizing UppP in a native-like environment

  • Systems biology perspectives:

    • Genome-scale metabolic modeling to understand UppP in the context of cellular metabolism

    • Synthetic biology approaches to create minimal cells with engineered UppP variants

    • Proteomics to identify interaction partners and regulatory networks

    • In vivo monitoring of peptidoglycan synthesis to directly observe UppP function

  • Comparative genomics and evolution:

    • Analysis of UppP sequence conservation and variation across different bacterial phyla

    • Investigation of horizontal gene transfer and antibiotic resistance spread

    • Exploration of UppP redundancy with other phosphatases in various bacterial species

  • Technological innovations:

    • Microfluidics-based assays for high-throughput enzyme kinetics

    • CRISPR-Cas9 genome editing to study UppP in native organisms

    • Single-molecule enzymology to observe individual catalytic cycles

    • Advanced computational models with improved membrane protein prediction capabilities

These emerging approaches will help resolve current knowledge gaps and provide new insights into UppP function across bacterial species including Arthrobacter aurescens.

How might understanding UppP function contribute to developing new strategies against antibiotic-resistant bacteria?

UppP represents a promising target for addressing antibiotic resistance due to its essential role in bacterial cell wall synthesis:

  • Novel inhibitor development:

    • Direct UppP inhibitors could provide an alternative to bacitracin with improved properties

    • Dual-target inhibitors affecting both UppP and other enzymes in the peptidoglycan synthesis pathway

    • Compounds that exploit species-specific differences in UppP structure for selective targeting

  • Resistance modulation strategies:

    • UppP inhibitors as adjuvants to restore sensitivity to other antibiotics

    • Targeting regulatory elements that control UppP expression

    • Competitive substrate analogs that reduce UppP efficiency without complete inhibition

  • Biofilm disruption approaches:

    • Cell wall synthesis inhibition as a strategy to prevent or disrupt biofilm formation

    • Combination therapies targeting both UppP and exopolysaccharide production

  • Diagnostic applications:

    • UppP activity assays as rapid tests for certain types of antibiotic resistance

    • Species-specific UppP detection for bacterial identification

    • Monitoring UppP mutations as markers for evolving resistance

These approaches are particularly relevant for addressing multidrug-resistant bacteria, where traditional antibiotics are failing. Understanding the molecular details of UppP function in Arthrobacter aurescens and other bacterial species will be instrumental in developing these new therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.