Recombinant Arthrobacter aurescens UPF0060 membrane protein AAur_4166 (AAur_4166)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AAur_4166; UPF0060 membrane protein AAur_4166
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Paenarthrobacter aurescens (strain TC1)
Target Names
AAur_4166
Target Protein Sequence
MTILKTTILFVLAAVAEIGGAWLIWQAVREGKAWWWAGLGVVALGIYGFFAAFQPDAHFG RVLAAYGGVFIAGSLGWGMLMDGFRPDRWDVIGAAICIVGVGVIMFAPRPGG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AAur_4166 and what organism does it come from?

AAur_4166 is a 112-amino acid membrane protein belonging to the UPF0060 family of proteins found in Arthrobacter aurescens (also known as Paenarthrobacter aurescens), specifically from strain TC1. This bacterium is a Gram-positive, aerobic soil microorganism with remarkable environmental persistence capabilities, originally isolated from an atrazine spill site . The protein is encoded by the AAur_4166 gene located on the main chromosome of A. aurescens, which consists of a 4,597,686 bp circular chromosome and two plasmids (pTC1 and pTC2) . The UPF0060 designation indicates that while the protein has been identified and sequenced, its precise biological function remains uncharacterized. Arthrobacter species are among the most frequently isolated indigenous aerobic bacteria found in soils, and their proteins often contribute to the organism's metabolic versatility and survival capabilities in harsh environments .

How is recombinant AAur_4166 typically produced and what expression systems are most effective?

Recombinant AAur_4166 is typically produced using prokaryotic expression systems, with E. coli being the most commonly employed host organism . For optimal expression, the protein sequence is usually cloned into bacterial expression vectors that incorporate affinity tags to facilitate purification. Based on available research materials, the most common approach involves adding an N-terminal histidine tag (His-tag) to the protein . This tagging strategy enables efficient purification using immobilized metal affinity chromatography (IMAC).

The expression process typically involves these methodological steps:

  • Gene synthesis or PCR amplification of the AAur_4166 coding sequence

  • Cloning into an appropriate expression vector with an inducible promoter (e.g., T7 or tac)

  • Transformation into an E. coli expression strain optimized for membrane proteins (e.g., C41(DE3) or C43(DE3))

  • Culture growth under controlled conditions (typically 37°C until mid-log phase)

  • Induction of protein expression (usually with IPTG at reduced temperatures of 16-25°C)

  • Harvesting cells and membrane fraction isolation

  • Solubilization with appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Purification via affinity chromatography

What storage and handling conditions are recommended for maintaining AAur_4166 stability?

Maintaining the stability of AAur_4166 during storage and experimental handling requires specific conditions to preserve structural integrity and functionality. The protein is typically provided as a lyophilized powder, which should be briefly centrifuged prior to opening to ensure all material is at the bottom of the container . Reconstitution should be performed in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 30-50% and aliquot the protein solution to avoid repeated freeze-thaw cycles .

The recommended storage temperature is -20°C or -80°C for extended preservation periods . For short-term work (up to one week), working aliquots can be stored at 4°C . The storage buffer typically consists of a Tris/PBS-based solution at pH 8.0 with 6% trehalose for the lyophilized form, or a Tris-based buffer with 50% glycerol for the reconstituted protein . Researchers should note that membrane proteins like AAur_4166 are particularly sensitive to freeze-thaw cycles, which can lead to protein denaturation and aggregation. Therefore, a single-use aliquot strategy is strongly recommended to maintain protein quality across experiments and ensure reproducible results.

How can AAur_4166 be incorporated into experimental designs for membrane protein research?

Incorporating AAur_4166 into experimental designs for membrane protein research requires careful consideration of the protein's properties and the specific research questions being addressed. When designing experiments involving this membrane protein, researchers should follow systematic experimental design principles including proper definition of variables, formulation of testable hypotheses, and implementation of appropriate controls . For studies focusing on AAur_4166's structure-function relationships, a between-subjects design comparing wild-type and mutant versions of the protein can reveal the significance of specific amino acid residues.

A comprehensive experimental approach might include:

  • Biophysical characterization: Circular dichroism spectroscopy to analyze secondary structure elements, particularly the alpha-helical content expected in membrane proteins. This provides baseline structural data before proceeding to functional studies.

  • Reconstitution studies: Incorporating purified AAur_4166 into artificial membrane systems such as liposomes or nanodiscs to study its behavior in a membrane environment. This approach allows for controlled assessment of protein orientation and potential functional activities.

  • Interaction analyses: Employing techniques such as pull-down assays, crosslinking studies, or surface plasmon resonance to identify potential binding partners within the Arthrobacter aurescens proteome. These experiments should include negative controls with unrelated membrane proteins to establish specificity.

  • Functional assays: Developing assays based on hypothesized functions, such as transport activity measurements or membrane integrity assessments, comparing systems with and without the incorporated AAur_4166.

When designing these experiments, researchers must clearly define independent variables (e.g., protein concentration, lipid composition) and dependent variables (e.g., binding affinity, transport rate) while controlling for extraneous variables that might confound results .

What methodological approaches are recommended for studying AAur_4166 interactions with other cellular components?

Studying the interactions between AAur_4166 and other cellular components requires a multi-faceted methodological approach combining in vitro and in vivo techniques. To begin this investigation, researchers should consider employing co-immunoprecipitation (co-IP) assays using antibodies against the His-tag of recombinant AAur_4166 to pull down potential interaction partners from Arthrobacter aurescens cell lysates. This approach can be complemented by proximity-based labeling techniques such as BioID or APEX, where AAur_4166 is fused to a biotin ligase or peroxidase that biotinylates proteins in close proximity, allowing subsequent purification and identification via mass spectrometry.

For more direct assessment of protein-protein interactions, researchers can utilize techniques such as:

  • Yeast two-hybrid screening: By creating fusion constructs with AAur_4166 as bait against an A. aurescens genomic library, potential interactors can be identified, though this approach may be challenging for membrane proteins.

  • Split-GFP complementation assays: By tagging AAur_4166 and candidate interactors with complementary GFP fragments, interactions can be visualized in living cells through fluorescence restoration.

  • Surface plasmon resonance (SPR): This technique allows quantitative measurement of binding kinetics between purified AAur_4166 and candidate interactors in a label-free environment.

  • Crosslinking mass spectrometry: By using chemical crosslinkers and subsequent mass spectrometry analysis, researchers can identify proteins that are spatially proximate to AAur_4166 in the native membrane.

When investigating membrane protein interactions, it is crucial to validate results through multiple complementary techniques, as each method has inherent limitations. Additionally, researchers should include appropriate negative controls (e.g., using an unrelated membrane protein from A. aurescens) and positive controls when possible to ensure the specificity and sensitivity of the interaction detection methods.

How does AAur_4166 potentially contribute to Arthrobacter aurescens soil survival mechanisms?

The potential contribution of AAur_4166 to Arthrobacter aurescens soil survival mechanisms can be investigated through a systematic research approach combining genomic context analysis, phenotypic characterization, and environmental simulation experiments. Arthrobacter aurescens TC1, originally isolated from an atrazine spill site, demonstrates remarkable environmental persistence and metabolic versatility in soil environments . The genomic context of AAur_4166 should be examined first, noting its chromosomal location and proximity to genes involved in stress response, membrane integrity, or xenobiotic degradation pathways.

To determine AAur_4166's role in soil survival, researchers can implement the following methodological approaches:

  • Gene knockout studies: Creating an AAur_4166 deletion mutant and comparing its survival to wild-type A. aurescens under various soil stress conditions (desiccation, nutrient limitation, pH fluctuations, presence of xenobiotics).

  • Transcriptomic analysis: Measuring expression levels of AAur_4166 under different environmental stressors to determine conditions that upregulate the protein.

  • Membrane integrity assays: Comparing membrane permeability and fluidity between wild-type and AAur_4166 mutant strains using fluorescent dyes like propidium iodide or laurdan.

  • Environmental simulation experiments: Creating microcosms that mimic soil conditions with varying stress factors to compare long-term survival rates between wild-type and mutant strains.

Given that A. aurescens possesses a high number of predicted transporters and binding proteins (671, representing 12.38% of its genome) , AAur_4166 may function in nutrient acquisition or xenobiotic efflux systems that contribute to the bacterium's exceptional soil adaptability. Its membrane localization suggests potential roles in maintaining membrane integrity during environmental fluctuations or participating in signaling pathways that respond to extracellular conditions. These hypotheses can be systematically tested through the experimental approaches outlined above.

What comparative analysis methods can reveal insights about AAur_4166 function across bacterial species?

To systematically investigate AAur_4166 function through comparative analysis, researchers should:

  • Conduct phylogenetic analysis: Construct phylogenetic trees of UPF0060 family proteins to understand the evolutionary relationships and potential functional divergence among homologs. This approach can identify clusters of related proteins that might share functional properties.

  • Perform structural comparison: Use homology modeling based on experimentally determined structures of related proteins to predict structural features of AAur_4166 and its homologs, focusing on conserved motifs and domains.

  • Analyze genomic context: Examine the genetic neighborhood of AAur_4166 homologs across species to identify conserved gene clusters that might indicate functional relationships or metabolic pathways.

  • Implement co-expression analysis: Compare expression patterns of AAur_4166 homologs under similar environmental conditions across different bacterial species to identify conserved regulatory responses.

When interpreting comparative data, researchers should consider that Arthrobacter aurescens is most closely related to Tropheryma, Leifsonia, Streptomyces, and Corynebacterium glutamicum . Special attention should be given to homologs in these related genera, as they may share more functional similarities with AAur_4166 than more distantly related species. Additionally, the analysis should account for the unique ecological niche of A. aurescens as a soil bacterium with distinctive environmental adaptations, recognizing that approximately 13.2% (623 genes) of its genome appears to be unique to this bacterium .

What are the challenges in expressing and purifying membrane proteins like AAur_4166, and how can they be overcome?

Membrane proteins such as AAur_4166 present numerous challenges during expression and purification due to their hydrophobic nature, complex folding requirements, and dependence on lipid environments for structural integrity. The primary challenges include low expression yields, protein misfolding, aggregation, and difficulties in extracting and maintaining the protein in a functional state. These challenges stem from the inherent properties of membrane proteins, which require insertion into lipid bilayers for proper folding and function, a process that heterologous expression systems may not efficiently support.

To overcome these challenges, researchers can implement several advanced methodological approaches:

  • Expression system optimization: While E. coli is commonly used for AAur_4166 expression , alternative systems such as Pichia pastoris, insect cells, or cell-free expression systems may yield better results for functional studies. Each system should be evaluated with small-scale expression trials before scaling up.

  • Fusion partner strategies: Incorporating fusion partners such as MBP (maltose-binding protein), SUMO, or Mistic can enhance solubility and proper folding. These tags should be designed with precision-engineered protease cleavage sites for subsequent removal.

  • Membrane mimetic selection: The choice of detergents or membrane mimetics is critical for maintaining protein stability. A systematic screen of different detergents (e.g., DDM, LMNG, C12E8) and alternative membrane mimetics (nanodiscs, amphipols, SMALPs) should be conducted to identify optimal conditions for AAur_4166.

  • Purification strategy refinement: A multi-step purification approach typically yields better results than single-step methods. For His-tagged AAur_4166, IMAC can be followed by size exclusion chromatography to remove aggregates and detergent micelles.

Researchers should also implement quality control measures throughout the process, including SDS-PAGE analysis, Western blotting, and functional assays where possible. For particularly challenging membrane proteins, directed evolution approaches or the use of stabilizing mutations based on computational predictions can significantly improve expression and stability. These methodological refinements can substantially increase the yield of properly folded, functional AAur_4166 for subsequent structural and functional studies.

How can researchers design experiments to determine the molecular function of AAur_4166 despite its "uncharacterized" status?

Determining the molecular function of an uncharacterized protein like AAur_4166 requires a systematic, multi-faceted experimental approach that combines computational predictions, structural analysis, and functional assays. The UPF0060 designation indicates that this protein belongs to a family with unknown function, presenting both a challenge and an opportunity for novel discovery. Researchers should begin with computational analysis of the sequence and predicted structure to generate initial hypotheses about potential functions, followed by experimental validation through a series of targeted assays.

A comprehensive approach to functional characterization would include:

  • Computational function prediction: Apply tools such as InterPro, PFAM, and structure-based prediction algorithms to identify potential functional domains, binding motifs, or structural similarities to better-characterized proteins. These predictions should guide the design of subsequent experimental approaches.

  • Transcriptional context analysis: Examine the conditions under which AAur_4166 is expressed by performing RNA-seq analyses of A. aurescens under various environmental conditions and stressors. Proteins that are co-expressed with AAur_4166 may provide clues about its functional context.

  • Localization studies: Confirm the membrane localization of AAur_4166 through fluorescent tagging or immunolocalization in A. aurescens cells, and determine if it localizes to specific membrane regions or microdomains, which could indicate functional specialization.

  • Functional screening assays: Design a panel of assays testing various hypothesized functions, such as:

    • Transport assays using proteoliposomes reconstituted with AAur_4166

    • Binding assays with potential ligands identified through computational predictions

    • Stress response assays comparing wild-type and AAur_4166 deletion mutants

Each experiment should be designed with appropriate controls, including negative controls (e.g., testing an unrelated membrane protein) and positive controls when available (e.g., a related protein with known function). Additionally, researchers should implement a between-subjects experimental design when comparing wild-type and mutant strains, ensuring proper randomization and blinding where appropriate to minimize experimental bias .

What advanced structural biology techniques are most appropriate for studying the three-dimensional structure of AAur_4166?

The most appropriate techniques for studying AAur_4166 structure include:

  • X-ray crystallography: While challenging for membrane proteins, this technique can provide atomic-resolution structures if high-quality crystals can be obtained. Researchers should explore various crystallization conditions using vapor diffusion methods with detergent-solubilized AAur_4166, potentially incorporating lipidic cubic phase (LCP) crystallization approaches that better mimic membrane environments.

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology by eliminating the need for crystallization. For small proteins like AAur_4166 (112 amino acids), single-particle cryo-EM might be challenging, but advances in technology now allow structural determination of smaller proteins, especially if they form oligomers or can be incorporated into larger scaffolds.

  • Nuclear magnetic resonance (NMR) spectroscopy: Solution NMR or solid-state NMR can be particularly valuable for smaller membrane proteins like AAur_4166. Isotopic labeling (15N, 13C) of the recombinant protein is required, and detergent micelles or nanodiscs can provide suitable membrane mimetics for NMR studies.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can provide insights into protein dynamics and solvent accessibility without requiring a complete structural determination. HDX-MS can be particularly valuable for identifying regions of AAur_4166 that undergo conformational changes upon ligand binding or environmental changes.

To complement these experimental approaches, computational methods such as molecular dynamics simulations can provide additional insights into protein dynamics and interactions with the lipid bilayer. Researchers should also consider hybrid approaches that integrate data from multiple structural techniques to overcome the limitations of individual methods. For example, low-resolution structural data from cryo-EM or small-angle X-ray scattering (SAXS) can be combined with high-resolution data from NMR or computational models to develop a comprehensive structural understanding of AAur_4166.

How can mutagenesis studies be designed to elucidate structure-function relationships in AAur_4166?

Mutagenesis studies represent a powerful approach to elucidate structure-function relationships in membrane proteins like AAur_4166. By systematically altering specific amino acid residues and assessing the resulting functional changes, researchers can identify critical residues involved in protein folding, stability, oligomerization, and potential functional activities. A well-designed mutagenesis study requires careful planning of mutation strategies, selection of appropriate assays, and implementation of rigorous controls.

A comprehensive mutagenesis approach for AAur_4166 should include:

  • Rational design of mutations: Based on sequence conservation analysis, predicted structural features, and computational simulations, researchers should target:

    • Highly conserved residues across the UPF0060 family

    • Residues in predicted functional domains or binding sites

    • Charged residues that may participate in ion interactions

    • Aromatic residues at predicted membrane-water interfaces

    • Glycine residues that may provide conformational flexibility

  • Mutation types to consider:

    • Alanine scanning: Systematically replacing residues with alanine to eliminate side chain functions

    • Conservative substitutions: Replacing residues with chemically similar ones to test specific chemical properties

    • Non-conservative substitutions: Introducing dramatic changes to test functional hypotheses

    • Cysteine scanning: Introducing cysteines for subsequent labeling or crosslinking studies

  • Functional assessment strategies:

    • Expression and folding analysis through Western blotting and circular dichroism

    • Membrane integration assessment using protease protection assays

    • Oligomerization assessment through crosslinking or analytical ultracentrifugation

    • Functional assays based on hypothesized activities (e.g., transport, binding, signaling)

  • Experimental design considerations:

    • Generate multiple mutants in parallel to enable systematic comparison

    • Include wild-type controls in every experiment

    • Implement between-subjects experimental design with appropriate randomization

    • Perform dose-response studies where applicable to assess quantitative changes in function

When interpreting mutagenesis data, researchers should consider that effects may be direct (altering a functional site) or indirect (disrupting protein folding or stability). Therefore, each mutation should be assessed for its effect on protein expression, folding, and stability before interpreting functional changes. Additionally, combinatorial mutations of multiple residues can reveal synergistic effects and functional interactions between different regions of the protein. Through systematic mutagenesis and functional characterization, researchers can develop a detailed map of structure-function relationships in AAur_4166, potentially revealing its biological role in Arthrobacter aurescens.

How should researchers interpret conflicting experimental results when studying AAur_4166 function?

Conflicting experimental results are common in membrane protein research due to the complex nature of these proteins and their sensitivity to experimental conditions. When studying AAur_4166, researchers may encounter discrepancies in functional assays, structural data, or interaction studies. Addressing these conflicts requires a systematic methodological approach rather than simply discarding contradictory results. Researchers should first carefully evaluate the experimental conditions used in each study, as differences in protein preparation, buffer composition, membrane mimetics, or assay conditions can significantly affect results.

A comprehensive strategy for resolving conflicting results includes:

  • Replication with standardized protocols: Repeat key experiments using carefully standardized protocols across different laboratories to determine if conflicts arise from methodological variations. This should include detailed documentation of all experimental parameters.

  • Orthogonal method validation: Apply multiple independent techniques to investigate the same property or function, as different methods have distinct limitations and biases. Agreement across orthogonal methods strengthens confidence in results.

  • Systematic parameter variation: Systematically vary experimental conditions (pH, salt concentration, temperature, detergent type) to determine if conflicts arise from condition-dependent behaviors of AAur_4166.

  • Concentration dependence analysis: Examine whether protein concentration affects results, as membrane proteins may exhibit different properties or functions at different concentrations due to oligomerization or aggregation effects.

When interpreting results, researchers should consider that apparent conflicts may reflect genuine biological complexity rather than experimental error. AAur_4166 may possess multiple functions or adopt different conformations under different conditions. Additionally, conflicts between in vitro and in vivo results may reveal important insights about the cellular context required for proper protein function. Rather than seeking to eliminate all conflicts, researchers should develop integrated models that account for seemingly contradictory results by incorporating condition-dependent behaviors and multiple functional states of the protein.

What statistical approaches are most appropriate for analyzing experimental data related to AAur_4166?

The following statistical approaches are particularly relevant for AAur_4166 research:

  • For comparison studies (e.g., wild-type vs. mutant AAur_4166):

    • Parametric tests such as t-tests or ANOVA for normally distributed data with homogeneous variance

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when normality assumptions are violated

    • Mixed-effects models for experiments with repeated measures or nested designs

    • Multiple comparison corrections (e.g., Bonferroni, Holm-Sidak, or FDR) when testing multiple hypotheses

  • For dose-response experiments (e.g., ligand binding or activity assays):

    • Nonlinear regression for fitting appropriate models (e.g., Hill equation, Michaelis-Menten kinetics)

    • Comparison of curve parameters (EC50, Vmax, Hill coefficient) between experimental conditions

    • Bootstrap or jackknife resampling to estimate parameter uncertainty

  • For structural data analysis:

    • Clustering algorithms for grouping similar conformational states

    • Principal component analysis for identifying major modes of structural variation

    • Cross-correlation analyses for identifying coordinated movements between protein regions

  • For omics-scale experiments (e.g., interactome studies):

    • Network analysis tools to identify significant interactions and functional clusters

    • Enrichment analyses to identify overrepresented functional categories

    • False discovery rate control methods to manage type I errors in multiple comparisons

Regardless of the specific statistical approach, researchers should report effect sizes and confidence intervals alongside p-values, as these provide more informative measures of biological significance and uncertainty. Power analyses should be conducted during experimental planning to ensure sufficient sample sizes for detecting biologically meaningful effects. Additionally, researchers should consider implementing pre-registration of analysis plans before conducting experiments to minimize bias in analytical decision-making and enhance reproducibility.

What are the most common pitfalls in experimental design when studying membrane proteins like AAur_4166?

Studying membrane proteins like AAur_4166 presents numerous experimental design challenges that can lead to misleading results or failed experiments if not properly addressed. Understanding and avoiding these common pitfalls is essential for generating reliable and reproducible data. The most significant experimental design challenges stem from the hydrophobic nature of membrane proteins, their dependence on lipid environments, and their often complex folding and assembly requirements.

Common pitfalls in membrane protein experimental design include:

  • Inadequate protein stabilization: Failure to identify optimal detergents or membrane mimetics that maintain AAur_4166 in a native-like, functional state. Researchers should systematically screen multiple detergents and lipid compositions rather than relying on conditions that worked for other membrane proteins.

  • Overlooking oligomerization states: Many membrane proteins function as oligomers, and experimental conditions can artificially promote or disrupt these associations. Researchers should verify the oligomeric state of AAur_4166 under their experimental conditions using techniques such as size exclusion chromatography, analytical ultracentrifugation, or native PAGE.

  • Insufficient quality control: Proceeding with functional or structural studies without verifying protein integrity, homogeneity, and proper folding. Each preparation of AAur_4166 should be assessed using multiple quality control methods (SDS-PAGE, Western blotting, circular dichroism) before use in downstream applications.

  • Neglecting the impact of tags and fusion partners: Affinity tags (e.g., His-tags) may interfere with protein function or structure, particularly for small membrane proteins like AAur_4166. Control experiments with tag-cleaved protein or differently positioned tags should be conducted to assess potential artifacts.

Furthermore, experimental design should follow systematic principles with clearly defined variables, appropriate controls, and careful randomization . Between-subjects designs comparing wild-type and mutant versions of AAur_4166 should ensure equivalent protein quality and experimental conditions across groups. Within-subjects designs examining AAur_4166 under different conditions must account for potential carryover effects or protein degradation over time. By anticipating these common pitfalls and implementing rigorous experimental design principles, researchers can significantly enhance the reliability and reproducibility of their studies on AAur_4166 and other membrane proteins.

How can computational approaches complement experimental studies of AAur_4166?

Computational approaches offer powerful complementary tools to experimental studies of AAur_4166, providing insights that may be difficult or impossible to obtain through laboratory methods alone. A well-integrated computational strategy can guide experimental design, help interpret experimental results, and generate new hypotheses about protein function and mechanism. For uncharacterized membrane proteins like AAur_4166, computational methods are particularly valuable for making initial functional predictions that can direct subsequent experimental investigations.

Key computational approaches that complement experimental studies include:

  • Homology modeling and structural prediction: Despite the "uncharacterized" designation of AAur_4166, modern structure prediction algorithms such as AlphaFold2 can generate high-confidence structural models based on remote homology and physicochemical principles. These models can identify potential binding sites, structural motifs, and conformational dynamics that inform experimental design.

  • Molecular dynamics simulations: Simulating AAur_4166 in explicit membrane environments can reveal dynamics not captured by static structural methods, including conformational changes, lipid interactions, and potential permeation pathways. These simulations can range from all-atom models (highest accuracy but computationally expensive) to coarse-grained approaches (allowing longer timescales and larger systems).

  • Protein-ligand docking: Virtual screening of compound libraries against predicted binding sites on AAur_4166 can identify potential ligands or substrates for experimental validation. This approach is particularly valuable when the protein's function is unknown, as it can suggest possible roles based on binding preferences.

  • Genomic context and co-evolution analysis: Examining patterns of gene neighborhood conservation and amino acid co-evolution across bacterial species can reveal functional associations and important structural contacts within AAur_4166.

What are the most promising avenues for future research on AAur_4166 and related UPF0060 family proteins?

The uncharacterized nature of AAur_4166 and the UPF0060 family presents numerous opportunities for groundbreaking research that could elucidate novel aspects of bacterial membrane biology. Future research directions should build upon current knowledge while employing innovative approaches to address fundamental questions about this protein family. The most promising avenues combine cutting-edge technologies with systematic investigative strategies to decode the functional and evolutionary significance of these conserved membrane proteins.

Particularly promising research directions include:

  • Comparative genomics and evolutionary analysis: A comprehensive analysis of UPF0060 family distribution across bacterial phyla could reveal patterns of conservation, gene loss, or duplication that correlate with specific bacterial lifestyles or environmental adaptations. This approach could identify which bacterial species rely most heavily on these proteins and under what ecological circumstances.

  • Systems biology integration: Investigating AAur_4166 within the broader context of Arthrobacter aurescens cellular networks through techniques such as genome-scale metabolic modeling, protein-protein interaction mapping, and multi-omics integration. This systems-level perspective could place AAur_4166 within specific pathways or functional modules.

  • In situ structural studies: Applying emerging technologies such as cryo-electron tomography to visualize AAur_4166 in its native membrane environment, potentially revealing its organization, interactions, and structural dynamics under physiologically relevant conditions.

  • Synthetic biology applications: Exploring the potential utility of AAur_4166 in engineered biological systems, such as biosensors or bioremediation applications, leveraging the exceptional environmental resilience of Arthrobacter aurescens.

Each of these research directions should employ rigorous experimental design principles, including clear definition of variables, appropriate controls, and replication . The between-subjects design would be particularly suitable for comparative studies examining different UPF0060 family members, while within-subjects approaches could track dynamic changes in protein behavior under varying conditions. By pursuing these promising research avenues, scientists can not only characterize AAur_4166 specifically but also contribute to our broader understanding of membrane protein evolution and bacterial adaptation to environmental challenges.

How might AAur_4166 research contribute to understanding Arthrobacter aurescens environmental adaptation mechanisms?

Research on AAur_4166 has significant potential to enhance our understanding of Arthrobacter aurescens environmental adaptation mechanisms, particularly given this organism's remarkable ability to survive in harsh soil conditions and xenobiotic-contaminated environments. Arthrobacter aurescens TC1 was originally isolated from an atrazine spill site, demonstrating its capacity to thrive in contaminated soils . As a membrane protein, AAur_4166 likely plays a role in mediating interactions between the bacterium and its external environment, potentially contributing to the organism's stress resistance, metabolic versatility, or xenobiotic degradation capabilities.

To systematically investigate AAur_4166's role in environmental adaptation, future research should:

  • Characterize expression patterns under environmental stressors: Implementing RNA-seq and proteomics analyses to determine how AAur_4166 expression responds to various environmental challenges, including desiccation, temperature fluctuations, nutrient limitation, and exposure to contaminants such as atrazine. Temporal expression patterns could reveal whether the protein is involved in immediate stress responses or longer-term adaptation.

  • Investigate membrane remodeling dynamics: Examining how AAur_4166 might contribute to membrane composition and structure changes that occur during adaptation to environmental stressors. Lipidomics approaches coupled with membrane fluidity assessments could reveal correlations between AAur_4166 activity and membrane physical properties.

  • Analyze soil survival phenotypes: Conducting long-term soil microcosm experiments comparing wild-type A. aurescens to AAur_4166 knockout mutants under various environmental scenarios, measuring survival rates, metabolic activities, and gene expression patterns over extended time periods.

  • Explore interspecies interactions: Investigating whether AAur_4166 plays a role in communication or competition with other soil microorganisms, potentially contributing to the ecological success of A. aurescens in complex soil communities.

This research is particularly relevant considering that approximately 13.2% (623 genes) of the A. aurescens genome appears to be unique to this bacterium, suggesting specialized niche adaptations . Understanding the role of AAur_4166 in environmental resilience could not only elucidate fundamental mechanisms of bacterial adaptation but also inform biotechnological applications, including bioremediation strategies for contaminated soils and the development of robust bacterial chassis for environmental applications.

What techniques are emerging that could revolutionize the study of difficult-to-characterize membrane proteins like AAur_4166?

The field of membrane protein research is experiencing rapid technological advancement, with several emerging techniques that could significantly accelerate the characterization of proteins like AAur_4166. These innovative approaches address long-standing challenges in membrane protein expression, purification, structural determination, and functional analysis, offering new possibilities for decoding the roles of uncharacterized membrane proteins.

Particularly promising emerging techniques include:

  • AI-driven structure prediction: The revolutionary advances in protein structure prediction algorithms such as AlphaFold and RoseTTAFold have dramatically improved our ability to model membrane protein structures without experimental determination. These predictions can provide high-confidence structural models of AAur_4166 that can guide experimental design and functional hypothesis generation.

  • Single-molecule methods: Techniques such as single-molecule FRET, single-molecule force spectroscopy, and single-particle tracking allow researchers to observe individual AAur_4166 molecules, revealing heterogeneity, rare conformational states, and dynamic behaviors that are masked in ensemble measurements.

  • Microfluidic approaches: Lab-on-a-chip systems for high-throughput screening of membrane protein stability conditions, crystallization, or functional assays can dramatically accelerate the optimization process for working with challenging proteins like AAur_4166.

  • In-cell structural biology: Methods such as in-cell NMR, in-cell EPR, and intracellular FRET enable structural and dynamic studies of membrane proteins in their native cellular environment, avoiding artifacts associated with detergent extraction or reconstitution.

Additionally, emerging membrane mimetic systems such as lipodisq nanoparticles, native nanodiscs, and synthetic cell membranes offer improved platforms for maintaining membrane proteins in near-native environments during structural and functional studies. These systems better preserve the lipid environment necessary for proper membrane protein folding and function compared to traditional detergent micelles.

For functional characterization, techniques combining electrophysiology with spectroscopy (spectro-electrophysiology) allow simultaneous measurement of functional activity and conformational changes, providing direct correlations between structure and function. Furthermore, massively parallel approaches such as deep mutational scanning enable comprehensive mapping of sequence-function relationships by simultaneously assessing thousands of protein variants. These emerging techniques, used in combination with established methods, have the potential to revolutionize our understanding of challenging membrane proteins like AAur_4166.

How can researchers develop a comprehensive experimental roadmap for characterizing AAur_4166?

Developing a comprehensive experimental roadmap for characterizing AAur_4166 requires a strategic, multi-phase approach that integrates diverse methodologies and builds knowledge systematically. An effective characterization strategy should proceed from basic biochemical and structural characterization to detailed functional analysis and ultimately to biological context studies within Arthrobacter aurescens. This methodical progression ensures that each experimental phase informs subsequent investigations, maximizing efficiency and knowledge gain.

A well-structured experimental roadmap should include these sequential phases:

  • Phase 1: Preliminary Characterization

    • Optimize expression and purification protocols for generating high-quality AAur_4166 protein

    • Perform basic biochemical characterization (oligomeric state, stability, post-translational modifications)

    • Generate high-quality structural predictions using computational methods

    • Develop antibodies or tagged constructs for localization and interaction studies

  • Phase 2: Structural Investigation

    • Determine experimental structure using appropriate methods (X-ray crystallography, cryo-EM, NMR)

    • Perform molecular dynamics simulations to understand conformational dynamics

    • Identify potential functional sites through structure analysis and conservation mapping

    • Initiate structure-guided mutagenesis to validate key structural features

  • Phase 3: Functional Characterization

    • Develop and implement functional assays based on structural insights and bioinformatic predictions

    • Perform comprehensive mutagenesis studies targeting predicted functional residues

    • Identify potential binding partners, substrates, or ligands through screening approaches

    • Characterize the membrane environment dependencies of AAur_4166 function

  • Phase 4: Biological Context Analysis

    • Generate and characterize knockout/knockdown mutants in A. aurescens

    • Perform transcriptomics and proteomics under various environmental conditions

    • Investigate phenotypic consequences of AAur_4166 perturbation in response to environmental stressors

    • Analyze ecological and evolutionary context through comparative genomics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.