Recombinant Arthrobacter chlorophenolicus ATP synthase subunit a (atpB)

What is the structure and function of Arthrobacter chlorophenolicus ATP synthase subunit a?

ATP synthase subunit a (atpB) in Arthrobacter chlorophenolicus functions as a critical component of the F0 sector of ATP synthase. The protein consists of 266 amino acids with a specific sequence beginning with MIALALPAQDSGEFTPPGINEMHLPAILPWGAAEGFSKQ and continuing through to IEGALHADSH . Functionally, it participates in the proton channel formation within the membrane-embedded F0 portion of the ATP synthase complex. This subunit is essential for the rotational mechanism that couples proton translocation across the membrane to ATP synthesis. Unlike soluble proteins, structural studies of this membrane protein require specialized techniques due to its hydrophobic nature and membrane integration.

What are the optimal storage conditions for recombinant Arthrobacter chlorophenolicus atpB?

For optimal stability and activity, store recombinant Arthrobacter chlorophenolicus atpB at -20°C in Tris-based buffer with 50% glycerol . For extended storage periods, -80°C is recommended to minimize protein degradation . Working aliquots should be maintained at 4°C for no longer than one week, and repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of functional activity . Additionally, researchers should validate protein integrity after extended storage using analytical techniques such as SDS-PAGE or functional assays specific to ATP synthase activity.

How does the amino acid sequence of atpB in A. chlorophenolicus compare to other bacterial species?

The atpB sequence in Arthrobacter chlorophenolicus (UniProt: B8HAZ5) reveals evolutionary adaptations specific to this soil bacterium . Comparative analysis shows conserved domains typical of F-type ATPases, particularly in regions responsible for proton translocation. The protein's hydrophobicity profile indicates multiple transmembrane segments consistent with its role in the membrane-spanning portion of ATP synthase. Sequence alignment with other bacterial ATP synthase subunits demonstrates conservation of critical functional residues while exhibiting species-specific variations that may reflect adaptation to Arthrobacter's environmental niche, including its ability to metabolize aromatic compounds such as 4-chlorophenol .

What expression systems are most effective for producing recombinant Arthrobacter chlorophenolicus atpB?

The expression of membrane proteins like Arthrobacter chlorophenolicus atpB presents significant challenges due to potential toxicity to host cells and proper membrane integration requirements. For successful expression, bacterial systems utilizing E. coli strains specially designed for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3)) yield better results when combined with fusion tags that enhance solubility. Expression should be conducted at lower temperatures (16-20°C) with reduced inducer concentrations to minimize inclusion body formation. For higher quality protein, consider using a cell-free expression system supplemented with lipid nanodiscs or detergents to facilitate proper folding of this highly hydrophobic protein. Expression validation should incorporate Western blotting with anti-His or appropriate tag antibodies, followed by verification of proper folding through activity assays.

How can researchers effectively analyze the role of atpB in energy metabolism in Arthrobacter species?

To analyze atpB's role in energy metabolism:

• Generate conditional knockdown or CRISPR-interference constructs targeting atpB, as complete knockouts may be lethal

• Perform oxygen consumption measurements using Clark-type electrodes under varying conditions

• Conduct comparative transcriptomics and proteomics analyses under different oxygen supply conditions, similar to methods used in other Arthrobacter metabolism studies

• Measure ATP synthesis rates in isolated membrane vesicles

• Use fluorescent probes to monitor membrane potential and proton gradients

Researchers should note that high oxygen supply significantly impacts central carbon metabolism in Arthrobacter species, affecting tricarboxylic acid cycle and purine metabolism while inhibiting glycolysis and other pathways . This interplay between oxygen levels and energy metabolism provides a crucial context for studying atpB function.

What techniques are most appropriate for structural determination of Arthrobacter chlorophenolicus atpB?

Structural determination of membrane proteins like atpB requires specialized approaches:

For atpB specifically, detergent screening is essential during purification to identify conditions that maintain structural integrity. Consider using nanodiscs or amphipols to stabilize the protein in a lipid-like environment. Cross-validation with biochemical assays that measure proton conductance would confirm structural integrity correlates with function.

How can Arthrobacter chlorophenolicus atpB be used in comparative studies of bacterial bioenergetics?

Arthrobacter chlorophenolicus atpB offers unique research opportunities for comparative bioenergetics due to this bacterium's environmental adaptability. Researchers can employ this protein to:

• Compare energy coupling mechanisms across bacterial species adapted to different environmental niches

• Investigate how ATP synthase components evolved in soil bacteria that metabolize complex aromatic compounds

• Examine adaptation mechanisms to varying oxygen conditions, as Arthrobacter shows significant metabolic shifts under different oxygen supply levels

• Study the correlation between ATP synthesis efficiency and the organism's capacity to degrade environmental pollutants

When designing comparative experiments, researchers should account for the unique growth characteristics of Arthrobacter species, which demonstrate varying growth rates in specialized media. For example, A. chlorophenolicus A6 exhibits a maximum specific growth rate (μmax) of 0.118/h in media containing 4-chlorophenol, significantly higher than related strains .

What methodologies are recommended for studying the interaction between atpB and other ATP synthase subunits?

To elucidate interactions between atpB and other ATP synthase components:

• Employ co-immunoprecipitation using antibodies against atpB or fusion tags, followed by mass spectrometry to identify interaction partners

• Utilize crosslinking studies with BS3 or formaldehyde to capture transient interactions

• Perform blue native PAGE to analyze intact ATP synthase complexes

• Apply proximity labeling techniques (BioID or APEX) to map the protein's neighborhood in situ

• Use bacterial two-hybrid systems modified for membrane protein interactions

How does the expression of atpB correlate with Arthrobacter chlorophenolicus's ability to degrade aromatic compounds?

The relationship between atpB expression and aromatic compound degradation capability represents a complex interaction between energy metabolism and specialized catabolic pathways. Research methodology should include:

• Transcriptional analysis comparing atpB expression levels when cells are grown on different carbon sources (glucose vs. aromatic compounds like 4-chlorophenol)

• Metabolic flux analysis using isotope-labeled substrates to track carbon flow

• Respiratory measurements under different substrate conditions

• Correlation analysis between ATP synthesis rates and degradation kinetics of aromatic compounds

A. chlorophenolicus has demonstrated superior capacity to grow on 4-chlorophenol compared to other Arthrobacter isolates, with PCR analysis confirming the presence of specific degradation genes including cphA-I and cphC-I . This degradation capability may require enhanced energy coupling, potentially involving optimized ATP synthase function. The energetic cost of aromatic compound metabolism likely necessitates efficient ATP synthesis, making atpB a potential control point for this specialized metabolic capability.

What are common difficulties in purifying recombinant Arthrobacter chlorophenolicus atpB and how can they be overcome?

Purification of membrane proteins like atpB presents several challenges:

When purifying atpB, researchers should consider that the tag type will be determined during the production process . This flexibility allows optimization of expression constructs based on preliminary results, but requires careful validation of each construct's functionality.

What are the most effective experimental designs for studying atpB's role in Arthrobacter adaptation to different environmental conditions?

For studying atpB's role in environmental adaptation:

• Design growth experiments across a gradient of environmental conditions (temperature, pH, nutrient limitation, pollutant concentration)

• Implement chemostat cultures to maintain steady-state conditions while varying specific parameters

• Compare wild-type with atpB-modified strains (point mutations or expression level variants)

• Combine physiological measurements (growth rates, substrate consumption) with molecular analyses (transcriptomics, proteomics)

• Incorporate field-relevant conditions, such as phyllosphere colonization experiments

Phyllosphere performance tests have shown that A. chlorophenolicus A6 can successfully colonize plant surfaces, with population sizes increasing at least one order of magnitude after 24 hours under high humidity conditions . This environmental adaptability may involve ATP synthase regulation, making atpB an important target for understanding how this bacterium thrives in diverse niches, from soil to plant surfaces to pollutant-rich environments.

How might structural modifications of Arthrobacter chlorophenolicus atpB impact the efficiency of ATP synthesis?

Future research on structural modifications of atpB should focus on:

• Site-directed mutagenesis of conserved residues in proton-conducting channels to alter coupling efficiency

• Chimeric constructs combining domains from atpB proteins of different species to identify adaptation-specific regions

• Introduction of non-canonical amino acids at key positions to provide spectroscopic probes for conformational studies

• Computational prediction of mutations that might enhance stability or activity, followed by experimental validation

The full amino acid sequence of atpB provides an excellent foundation for these structure-function studies. Researchers should pay particular attention to transmembrane regions and conserved motifs that likely participate in proton translocation and rotor interaction within the ATP synthase complex.

What novel applications could emerge from research on Arthrobacter chlorophenolicus atpB in bioremediation technologies?

Potential novel applications include:

• Engineering enhanced ATP synthase efficiency to improve growth and pollutant degradation rates in bioremediation applications

• Developing biosensors based on atpB activity that respond to environmental pollutants

• Creating designer Arthrobacter strains with modified energy metabolism for specialized degradation of recalcitrant compounds

• Exploring the potential for phylloremediation (plant surface-based bioremediation) using Arthrobacter strains with optimized ATP synthesis capacity

A. chlorophenolicus has already demonstrated promising results in phyllosphere colonization tests, performing comparably to model phyllosphere bacteria . This suggests potential applications in plant surface-based bioremediation, where efficient energy metabolism via optimized ATP synthase function could enhance the degradation of foliage-associated pollutants.

How can systems biology approaches integrate atpB function into broader metabolic networks in Arthrobacter chlorophenolicus?

Systems biology approaches for integrating atpB function should include: