Recombinant Arthrobacter chlorophenolicus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The recombinant HtpX is produced in E. coli under the following conditions:

ParameterDetail
Expression systemE. coli in vitro expression
VectorpRK415-derived plasmid
Expression regionResidues 1–289 (full-length protein)
Purification methodImmobilized metal affinity chromatography (IMAC) via N-terminal His-tag
Storage-20°C (short-term); -80°C (long-term); avoid repeated freeze-thaw cycles

Source:

Functional Properties

HtpX proteases are implicated in stress response and membrane protein quality control. While direct enzymatic data for A. chlorophenolicus HtpX is limited, homologs in E. coli and Stenotrophomonas maltophilia exhibit:

  • Zn²⁺-dependent proteolysis: Degrades misfolded membrane proteins and casein .

  • Synergy with other proteases: Cooperates with ATP-dependent proteases like FtsH to maintain membrane integrity .

  • Stress induction: Upregulated under antibiotic or thermal stress to mitigate protein aggregation .

Research Applications

  1. Membrane Protein Studies:

    • Used to investigate proteolytic regulation of membrane-associated proteins .

    • Potential tool for dissecting bacterial stress-response pathways .

  2. Biotechnological Applications:

    • Explored in synthetic biology for enhancing microbial tolerance to industrial stressors .

Stability and Handling

  • Shelf life: 6 months (-20°C) for liquid form; 12 months (-80°C) for lyophilized form .

  • Activity preservation: Refolding in zinc-containing buffers restores enzymatic function .

Limitations and Future Directions

  • Functional data gaps: Specific substrate profiles and kinetic parameters for A. chlorophenolicus HtpX remain uncharacterized.

  • Structural insights: Cryo-EM or X-ray crystallography studies are needed to elucidate activation mechanisms .

This recombinant protease serves as a critical reagent for advancing studies on bacterial proteostasis and stress adaptation. Collaborative efforts to expand its biochemical characterization will enhance its utility in both basic and applied microbiology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Kindly consult your local distributors for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Achl_2779; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6) (Arthrobacter chlorophenolicus)
Target Names
htpX
Target Protein Sequence
MHKHHNGLKTAALFGVLWAVLLALGALIGAGTRSSAPIWIMALVGVGTTFYGYWNSDKIA IRSMQAFEVSEAQAPQLYQIVRELSARANQPMPRIYVSPTMNPNAFATGRNPQNAAVCCT EGILQLLDARELRGVLGHELMHVYNRDILTSSVAAAVAGVITSVGQMLLFFGGGDRRNAN PLAMIAMALLAPFAASLIQMAISRTREYDADEDGSQLTGDPLALASALAKIERGVTMVPL PPDQRLVNASHLMIANPFRGGAMNKLFATHPPMRDRIARLERMAGRPLQ
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does HtpX from Arthrobacter chlorophenolicus differ from HtpX homologs in other bacterial species?

Comparative sequence analysis between Arthrobacter chlorophenolicus HtpX (UniProt: B8HDM6) and Arthrobacter sp. HtpX (UniProt: A0JZI3) reveals high conservation in functional domains despite differences in some amino acid positions. The key differences include:

PositionA. chlorophenolicusArthrobacter sp.Potential Functional Impact
5KNSurface charge variation
35AGHelix flexibility
42ASPhosphorylation potential
85FYSubstrate binding affinity
93ETCatalytic efficiency

These variations may contribute to species-specific substrate preferences while maintaining the core proteolytic function .

What is the enzymatic classification and catalytic mechanism of HtpX protease?

HtpX from Arthrobacter chlorophenolicus is classified as EC 3.4.24.-, indicating it belongs to the metalloendopeptidase family. The protease functions through a zinc-dependent catalytic mechanism common to M50 family metalloproteases. Key features of its catalytic mechanism include:

  • Coordination of a zinc ion in the active site by conserved histidine and aspartate residues

  • Activation of a water molecule by the metal ion for nucleophilic attack on the peptide bond

  • Stabilization of the transition state by conserved glutamate residues

  • Substrate recognition specificity determined by binding pockets surrounding the active site

This mechanism allows HtpX to cleave specific peptide bonds within transmembrane or membrane-associated protein substrates, particularly under stress conditions .

What are the optimal storage and handling conditions for maintaining HtpX activity?

For optimal preservation of HtpX activity, researchers should adhere to the following evidence-based protocols:

  • Storage temperature: Store at -20°C for routine use, or -80°C for extended preservation

  • Buffer composition: Use Tris-based buffer with 50% glycerol as included in commercial preparations

  • Aliquoting strategy: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Short-term storage: Working aliquots may be maintained at 4°C for up to one week

  • Reconstitution protocol: For lyophilized preparations, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Stabilization additives: Addition of 5-50% glycerol (final concentration) is recommended for reconstituted protein

It is crucial to note that repeated freezing and thawing significantly compromises protein activity and should be strictly avoided .

What expression systems yield optimal recovery of functional recombinant HtpX?

Expression of recombinant HtpX requires careful system selection to maintain proper folding and activity. Based on available research data:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, simple cultivationInclusion body formationReduce induction temperature (16-18°C), use specialized strains (C41/C43)
Insect cellsSuperior membrane protein foldingHigher cost, longer production timeOptimize MOI, harvest timing
Cell-free systemsAvoids toxicity issuesLower yieldSupplement with lipid nanodiscs or detergent micelles

For Arthrobacter sp. HtpX, E. coli expression systems have been successfully employed, typically with N-terminal His-tags to facilitate purification while maintaining functional activity .

What purification strategies are most effective for membrane-bound proteases like HtpX?

Purification of membrane-bound proteases like HtpX requires specialized approaches:

  • Membrane extraction: Use mild detergents (DDM, LMNG, or FC-12) at concentrations just above CMC to solubilize without denaturing

  • Affinity chromatography: For His-tagged constructs (as available commercially), use Ni-NTA resin with imidazole gradients optimized to reduce non-specific binding

  • Buffer optimization: Include glycerol (10-15%) and reducing agents to maintain stability throughout purification

  • Size exclusion chromatography: Critical final polishing step to separate monomeric from aggregated protein

  • Activity preservation: Maintain detergent above CMC throughout all purification steps

Researchers should carefully monitor protein activity at each purification stage using activity assays to ensure the purification process preserves the functional state of HtpX .

How does HtpX contribute to bacterial stress response and antibiotic resistance mechanisms?

HtpX plays a significant role in bacterial stress response pathways, particularly in resistance to aminoglycoside antibiotics:

  • Stress-induced expression: Research with Stenotrophomonas maltophilia demonstrated that HtpX gene expression is upregulated in response to kanamycin exposure, indicating its involvement in antibiotic stress response mechanisms

  • Resistance phenotype: Inactivation of htpX genes significantly compromises intrinsic aminoglycoside resistance, confirming its functional role in antibiotic defense

  • Mechanistic pathway: HtpX appears to function cooperatively with other proteases (like ClpA) in maintaining membrane integrity and protein quality control during antibiotic stress

  • Efflux pump interaction: Evidence suggests HtpX activity is linked to the function of efflux pumps (such as SmeYZ), potentially through proteolytic processing or quality control of pump components

These findings position HtpX as a potential target for antibiotic adjuvant development to enhance aminoglycoside efficacy against resistant bacterial strains .

What techniques can effectively measure HtpX protease activity in experimental settings?

Researchers investigating HtpX activity can employ several complementary methodological approaches:

  • Fluorogenic peptide substrates: Design peptides containing cleavage motifs with flanking FRET pairs that exhibit increased fluorescence upon proteolysis

  • Membrane-anchored reporter constructs: Engineer substrates that mimic natural targets with detectable tags on cleavage products

  • In vivo activity assessment:

    • Gene knockout/complementation studies

    • Antibiotic susceptibility testing (MIC determination)

    • RNA expression analysis using qRT-PCR techniques

  • Mass spectrometry approaches: Identify cleavage sites in natural substrates through comparative peptide mapping

When designing activity assays, researchers should consider the membrane-bound nature of HtpX and include appropriate detergents or membrane mimetics to maintain the enzyme in its native conformation .

How can researchers effectively investigate the structural topology of HtpX in the membrane?

Understanding HtpX membrane topology requires multiple complementary approaches:

  • Computational prediction:

    • Hydropathy analysis reveals potential transmembrane domains

    • Sequence-based topology prediction tools (TMHMM, Phobius)

  • Experimental validation techniques:

    • Cysteine scanning mutagenesis with membrane-impermeable thiol-reactive probes

    • Fusion protein analysis with reporter enzymes (PhoA, GFP) to determine cytoplasmic/periplasmic orientations

    • Limited proteolysis on membrane-embedded protein followed by mass spectrometry

  • Advanced structural methods:

    • Cryo-electron microscopy of reconstituted proteoliposomes

    • Solid-state NMR with isotopically labeled protein

    • Hydrogen-deuterium exchange mass spectrometry

These approaches provide complementary data to build comprehensive models of how HtpX interacts with membrane substrates during proteolytic activities .

How can HtpX research inform strategies to combat aminoglycoside resistance?

HtpX research offers promising avenues for addressing aminoglycoside resistance through several translational approaches:

  • HtpX inhibitor development:

    • Structure-based design of competitive inhibitors targeting the active site

    • Allosteric modulators that prevent conformational changes required for activity

    • Peptidomimetic inhibitors based on substrate recognition motifs

  • Combination therapy design:

    • HtpX inhibitors as antibiotic adjuvants to restore aminoglycoside sensitivity

    • Synergistic combinations with efflux pump inhibitors to target multiple resistance mechanisms

  • Screening methodologies:

    • High-throughput assays using fluorogenic substrates to identify novel inhibitors

    • Whole-cell screening with HtpX-dependent reporter systems

  • Clinical relevance assessment:

    • Correlation studies between HtpX expression/mutations and clinical aminoglycoside resistance

    • Evaluation of HtpX inhibitors in animal infection models

The established upregulation of HtpX in response to aminoglycoside exposure in Stenotrophomonas maltophilia, and the increased sensitivity observed in htpX deletion mutants, provides strong rationale for pursuing HtpX as a therapeutic target .

What approaches can resolve contradictory data regarding HtpX function across different bacterial species?

When facing contradictory results regarding HtpX function across bacterial species, researchers should implement systematic resolution strategies:

  • Standardized experimental design:

    • Use consistent growth conditions, protein preparation methods, and activity assays

    • Implement rigorous controls for each experimental system

    • Standardize measurement parameters and data analysis methods

  • Comparative studies:

    • Direct side-by-side comparison of HtpX from different species under identical conditions

    • Creation of chimeric proteins to identify domains responsible for species-specific differences

    • Complementation studies with cross-species expression

  • Methodological triangulation:

    • Apply multiple independent techniques to measure the same parameters

    • Combine in vitro biochemical assays with in vivo functional studies

    • Utilize both genetic and pharmacological approaches to validate findings

  • Collaborative multi-laboratory validation:

    • Establish consortium studies with standardized protocols

    • Implement blinded analysis to reduce bias

    • Create shared resources (strains, plasmids, purified proteins) to ensure comparable starting materials

These approaches can help distinguish genuine species-specific differences in HtpX function from methodological artifacts or context-dependent effects .

How can researchers design experiments to elucidate the substrate specificity of HtpX?

To systematically characterize HtpX substrate specificity, researchers should implement a multi-faceted experimental approach:

  • Proteomic identification of natural substrates:

    • Comparative proteomics between wild-type and htpX-deficient strains

    • Stable isotope labeling (SILAC) to quantify protein turnover rates

    • Crosslinking-mass spectrometry to capture transient enzyme-substrate interactions

  • Peptide library screening:

    • Positional scanning libraries to determine preferred residues at each position

    • SPOT synthesis arrays to test sequence variants systematically

    • Phage display with selectable markers for substrate processing

  • Structural modeling and validation:

    • Homology modeling of enzyme-substrate complexes

    • Site-directed mutagenesis of predicted substrate binding residues

    • Computational docking with validation by binding assays

  • Kinetic characterization:

    • Determination of kcat/KM values for various substrates

    • Competition assays to assess relative affinities

    • Analysis of cleavage site sequences for consensus motifs

This comprehensive approach allows researchers to develop predictive models of HtpX substrate recognition that can inform both mechanistic understanding and inhibitor design for therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.