Recombinant Arthrobacter chlorophenolicus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Key Definitions

  • Undecaprenyl-diphosphatase (UppP): A membrane-associated enzyme that hydrolyzes undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P), a critical step in bacterial cell wall synthesis and lipid II recycling .

  • Arthrobacter chlorophenolicus: A Gram-positive bacterium renowned for degrading 4-chlorophenol via a hydroxyquinol pathway, mediated by the cph gene cluster .

UppP in Other Bacterial Species

While Arthrobacter chlorophenolicus has not been directly linked to UppP, its role in other bacteria is well-documented.

Arthrobacter chlorophenolicus: Focus on 4-Chlorophenol Degradation

The species is best known for its cph gene cluster, which mediates 4-chlorophenol degradation via hydroxyquinol. No evidence links Arthrobacter chlorophenolicus to UppP or its recombinant production.

Relevant Research on Arthrobacter chlorophenolicus

AspectDetailsSources
4-CP Degradation Pathway- Hydroxyquinol intermediates; two functional hydroxyquinol 1,2-dioxygenases (cphA-I and cphA-II).
- Horizontal gene transfer implicated in cph cluster assembly.
Recombinant Proteins- Commercially available recombinant proteins include GROS (OPCA160683) and OPCA160687, unrelated to UppP.
- No UppP homologs identified in Arthrobacter genomes.

Potential Explanations for the Absence of Recombinant Arthrobacter UppP

  1. Misattribution of Species: UppP research in Bacillus or E. coli may have been conflated with Arthrobacter’s unrelated catabolic pathways.

  2. Lack of Functional Need: Arthrobacter chlorophenolicus may rely on alternative phosphatases (e.g., DgkA) for lipid II recycling, reducing evolutionary pressure to retain UppP.

  3. Uncharacterized Genomes: While Arthrobacter genomes lack annotated UppP homologs, genomic data for A. chlorophenolicus A6 remain limited .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal storage, working aliquots should be kept at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development for your product.
Synonyms
uppP; Achl_1910; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6) (Arthrobacter chlorophenolicus)
Target Names
uppP
Target Protein Sequence
MNWFEVALLGLVQGLTEFLPISSSAHLRIVGQFLPNAEDPGAAFTAITQLGTETAVVVYF WRDIVRIVKAWAGSLAGKVSRQDPDARMGWLVILGSLPIIVLGLLFQDQIESVLRSMWIV ATMLIVFGLILAVADAVGKQERDLTQLTYKHGILYGFAQAMALIPGVSRSGGTITAGLLM GYTREAAARYSFLLAIPAVFGSGLYQLYKVVSKDGITGPYGLPETALATVIAFVVGYVII GWFLKFVSTRSYRLFVWYRIFLGLALYLLLGFGVISA
Uniprot No.

Target Background

Function
This enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). It confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.