Recombinant Arthrobacter sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliqouting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
atpB; Arth_2611; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Arthrobacter sp. (strain FB24)
Target Names
atpB
Target Protein Sequence
MIALALPAQDSGEFNPPGIEEMHLPAILPWGAADGFSKQMLLVILSVVIIATFFLLAARK QQLVPGKLQFAGEAAYGFVRNSIAKDIIGGKDFMKYVPLLFSLFFFILVNNIYGAIPLIQ LPSFSHVGGAYVLAAIVYLTWIAIGVKKNGIKYFKLATVPTGVPVYILPIVIPIEIISNF LVRPVTHSLRLFATMLAGHLIVMIAGSGIEYLVMQENILLKGTSVLVLVGAIAMYMLEAL IMALQAYVFTLLTAIYIEGALHADSH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a in Arthrobacter sp.?

ATP synthase subunit a (encoded by atpB) plays crucial roles in providing the proton path from outside the membrane surface to the carboxylates of interacting c-subunits of the rotor. The a-subunit is essential for proper coupling of ATP synthesis to the proton motive force (PMF), participating in proton translocation through the FO domain that leads to rotation of the membrane-embedded ring-like rotor. This subunit prevents proton short-circuiting to the cytoplasm without rotation and likely contains the proton exit pathway leading to the cytoplasm . In Arthrobacter sp., as a member of the Actinobacteria phylum, the ATP synthase would be similar to other bacterial F-type ATP synthases (FOFO) found embedded in the cellular membrane, though with potential structural differences compared to ATP synthases from other bacterial phyla .

What expression systems are recommended for producing recombinant Arthrobacter sp. atpB?

For recombinant expression of Arthrobacter sp. atpB, heterologous expression systems similar to those successfully used for other bacterial ATP synthase subunits would be recommended. Based on protocols used for similar bacterial ATP synthases, E. coli expression systems are often employed. For example, successful recombinant expression and purification of A. baumannii F1-ATPase comprised of subunits α3:β3:γ:ε has been reported . For Arthrobacter sp. atpB, considerations should include:

  • Using E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Employing vectors with inducible promoters (e.g., T7 promoter systems)

  • Including affinity tags (His-tag or Strep-tag) for purification

  • Optimizing growth conditions (temperature, induction timing, media composition)

  • Considering co-expression with chaperones if folding difficulties arise

Purification protocols would typically involve detergent solubilization of membranes followed by affinity chromatography and size exclusion chromatography steps.

What are the best methods for assessing ATP synthase activity of recombinant Arthrobacter sp. a-subunit?

To assess ATP synthase activity of recombinant Arthrobacter sp. a-subunit, multiple complementary approaches should be employed:

ATP Hydrolysis Assays:

  • Measure ATPase activity using the coupled enzyme assay with pyruvate kinase and lactate dehydrogenase

  • Compare native activity (without detergent) and stimulated activity (with detergents like octylglucoside)

  • Quantify ATP hydrolysis rates as μmol ATP hydrolyzed per min per mg protein

ATP Synthesis Assays:

  • Utilize inverted membrane vesicles containing the recombinant ATP synthase

  • Generate artificial proton gradient using NADH or succinate as substrates

  • Measure ATP synthesis rates using luciferase-based luminescence assays

  • Test synthesis capacity across multiple pH conditions to determine optimal range

Proton Translocation Measurements:

  • Monitor proton translocation using pH-sensitive fluorescent dyes (e.g., ACMA)

  • Assess coupling efficiency between proton movement and ATP synthesis/hydrolysis

Comparing the recombinant Arthrobacter sp. ATP synthase activity with those of well-characterized bacterial ATP synthases would provide valuable context for interpretation of results .

How can I accurately determine the expression levels of recombinant atpB in heterologous systems?

Accurate determination of recombinant atpB expression levels requires a multi-faceted approach:

Protein Quantification Methods:

  • Western blotting using antibodies against the a-subunit or attached tags

    • Compare band intensities to known standards

    • Use specialized membrane protein extraction protocols to ensure complete recovery

  • Mass spectrometry-based quantification

    • Employ targeted approaches like selected reaction monitoring (SRM)

    • Use stable isotope-labeled peptide standards for absolute quantification

  • Fluorescence-based methods if using fluorescent protein fusions

RNA Level Assessment:

  • qRT-PCR to monitor transcription levels of atpB

  • RNA-seq for broader transcriptional context

Integration Assessment:

  • Visualize incorporation into ATP synthase complexes using Blue Native PAGE

  • Assess co-purification with other ATP synthase subunits

For membrane proteins like ATP synthase a-subunit, it's critical to distinguish between total expression and properly inserted/folded protein in the membrane. Assessment of β-subunit levels can serve as a reference point, as has been done in other ATP synthase studies .

Which residues in Arthrobacter sp. ATP synthase a-subunit are critical for proton translocation?

Based on homology with other bacterial ATP synthases, several key residues in Arthrobacter sp. ATP synthase a-subunit would be critical for proton translocation:

Conserved Essential Residues:

  • An arginine residue equivalent to Arg-210 in E. coli (likely in transmembrane helix 4) would be essential, as this residue:

    • Prevents proton short-circuiting to the cytoplasm

    • Causes a shift in the pKa of the essential carboxylate in c-subunits

  • Residues forming the proton entry pathway from the periplasm:

    • Polar residues in the periplasmic half-channels

    • Specific glutamate or aspartate residues that may form hydrogen bonds with water molecules

  • Residues forming the proton exit pathway to the cytoplasm:

    • Likely located within the a-subunit

Phylum-Specific Residues:
As an Actinobacteria member, Arthrobacter sp. may have specific adaptations in the a-subunit compared to other bacterial phyla. Comparative analysis with other Actinobacteria ATP synthases would be needed to identify these specific residues .

Mutational studies targeting these residues, followed by functional assays measuring ATP synthesis and hydrolysis rates, would be necessary to fully characterize their roles.

How does the a-subunit interact with other components of the ATP synthase complex in Arthrobacter sp.?

The a-subunit in Arthrobacter sp. ATP synthase likely engages in several critical interactions:

a-subunit and c-ring Interface:

  • Forms a crucial interface with the c-ring to facilitate proton translocation

  • Specific residues in transmembrane helices of the a-subunit would interact with the c-ring's outer surface

  • This interaction creates the pathway for protons to access and protonate the essential carboxylate groups on c-subunits

a-subunit and b-subunit Interface:

  • Interacts with the b-subunit(s) to form part of the peripheral stalk

  • This connection helps stabilize the stator assembly against the torque generated during catalysis

  • Based on other bacterial ATP synthases, this interface may have bacterial-specific features

a-subunit and Membrane Lipids:

  • Engages with the lipid bilayer through hydrophobic interactions

  • May have specific lipid-binding sites that affect function

Integration with Other Subunits:

  • Forms a functional unit with other FO components

  • Contributes to the structural stability of the entire ATP synthase complex

Structural studies using cryo-electron microscopy would be valuable for defining these interactions in detail, as has been done for other bacterial ATP synthases .

What is the molecular mechanism of proton translocation through the a-subunit in Arthrobacter sp. ATP synthase?

The molecular mechanism of proton translocation through the a-subunit in Arthrobacter sp. ATP synthase likely follows general principles established for bacterial F-type ATP synthases, but may have Actinobacteria-specific adaptations:

Proposed Translocation Pathway:

  • Protons from the periplasmic space enter through a half-channel in the a-subunit

  • The protons access and protonate the conserved carboxylate group (typically Asp or Glu) on a c-subunit

  • Rotation of the c-ring occurs as each c-subunit sequentially binds a proton

  • After a complete rotation, the protonated c-subunit reaches another half-channel in the a-subunit

  • A conserved arginine residue in the a-subunit (homologous to Arg-210 in E. coli) causes a shift in pKa of the carboxylate group

  • The proton dissociates and enters the exit half-channel leading to the cytoplasm

Critical Structural Elements:

  • Two aqueous half-channels in the a-subunit, separated by a hydrophobic barrier

  • Specific transmembrane helices containing polar residues that form these channels

  • A conserved arginine residue that prevents proton short-circuiting

Advanced techniques like molecular dynamics simulations, combined with site-directed mutagenesis of key residues and subsequent functional assays, would be necessary to fully elucidate this mechanism in Arthrobacter sp.

How do mutations in the a-subunit affect ATP synthesis efficiency and proton leakage in Arthrobacter sp.?

Mutations in the a-subunit would likely affect ATP synthesis efficiency and proton leakage in Arthrobacter sp. in several ways:

Effects on ATP Synthesis Efficiency:

  • Mutations in residues forming the proton half-channels could alter proton accessibility and flow rates

  • Changes to residues at the a-subunit/c-ring interface may disrupt the proper alignment needed for efficient proton transfer

  • Mutations affecting interaction with other subunits could compromise structural stability

Impact on Proton Leakage:

  • Alterations to the conserved arginine (equivalent to Arg-210 in E. coli) could lead to proton short-circuiting

  • Mutations that widen the half-channels or create alternative pathways might allow protons to bypass the normal route

  • Changes that affect the hydrophobic barrier between half-channels could increase passive proton leakage

Experimental Assessment Table:

Mutation TypeExpected Effect on ATP SynthesisExpected Effect on Proton LeakageMeasurement Methods
Conserved Arg to Lys/HisModerate to severe reductionPotential increaseATP synthesis assays, membrane potential measurements
Conserved Arg to Ala/GlySevere reduction or eliminationSignificant increaseATP synthesis assays, proton leakage assays
Polar residues in half-channelsReduced efficiencyVariable effectspH-dependent activity assays, proton translocation measurements
Interface residues with c-ringReduced efficiencyPotential increaseStructure analysis, ATP synthesis rates at varying PMF
Peripheral residuesMinimal effectsMinimal effectsComparative activity assays

Studies with the alkaliphilic B. pseudofirmus OF4 have shown that mutations in the a-subunit can have diverse effects on ATP synthesis activity depending on pH conditions and proton motive force levels . Similar methodologies could be applied to Arthrobacter sp. to characterize the effects of a-subunit mutations.

How does the structure and function of Arthrobacter sp. ATP synthase a-subunit compare to those from extremophiles?

The structure and function of Arthrobacter sp. ATP synthase a-subunit would show both similarities and differences when compared to extremophiles:

Comparison with Alkaliphiles:

  • Alkaliphilic Bacillus species have specific adaptations in their a-subunits for ATP synthesis at high pH

  • Key residues like Lys-180 in transmembrane helix 4 of B. pseudofirmus OF4 a-subunit are critical for ATP synthesis at high pH

  • Arthrobacter sp., not being an obligate alkaliphile, would likely lack these specific adaptations

  • Functional assays across pH ranges would reveal differences in pH optima for ATP synthesis

Comparison with Thermophiles:

  • Thermophilic ATP synthases (like those from Caldalkalibacillus thermarum) have adaptations for stability at high temperatures

  • The a-subunit of thermophiles may contain more hydrophobic residues and salt bridges

  • Arthrobacter sp. a-subunit would likely have typical mesophilic features with fewer stabilizing interactions

Comparison with Acidophiles:

  • Acidophilic bacteria have adaptations for functioning at low pH

  • Their a-subunits may contain modifications for proton handling in acidic environments

  • Arthrobacter sp. would likely have more neutral-adapted proton pathways

Structural Analysis Table:

FeatureArthrobacter sp. (Mesophile)AlkaliphilesThermophilesAcidophiles
Key a-subunit residuesStandard bacterial consensusLys-180 and other alkaliphile-specific residues Arg-180 (in C. thermarum)Acidophile-specific adaptations
pH range for activityLikely 6.0-8.57.5->11.0 8.0-10.52.0-5.0
Stability featuresModerateEnhanced membrane interactionsAdditional salt bridges, hydrophobic interactionsAcid-stable features
Proton handlingStandard bacterial mechanismAdaptations for proton capture at high pHSimilar to alkaliphilesAdaptations for high proton gradient

Understanding these differences would provide insights into how ATP synthases have evolved to function in diverse environmental conditions while maintaining their core catalytic function .

What are the optimal conditions for isolating functional recombinant Arthrobacter sp. ATP synthase containing the a-subunit?

The isolation of functional recombinant Arthrobacter sp. ATP synthase with intact a-subunit requires careful optimization of multiple parameters:

Membrane Preparation:

  • Cell lysis using gentle methods (e.g., osmotic shock, enzymatic digestion)

  • Differential centrifugation to isolate membrane fractions

  • Washing steps to remove peripheral proteins

Solubilization Conditions:

  • Selection of appropriate detergents (DDM, LMNG, or digitonin are often effective)

  • Detergent concentration optimization to maintain native interactions

  • Buffer composition with stabilizing agents (glycerol, lipids)

Purification Strategy:

  • Affinity chromatography using tags engineered on specific subunits

  • Ion exchange chromatography for additional purification

  • Size exclusion chromatography to isolate intact ATP synthase complexes

Stabilization Parameters:

  • Temperature control throughout purification (typically 4°C)

  • Addition of ATP or non-hydrolyzable ATP analogs

  • Inclusion of appropriate lipids to maintain native environment

  • pH optimization typically between 7.0-8.0

Quality Control Methods:

  • Blue Native PAGE to verify complex integrity

  • Activity assays (ATP hydrolysis and synthesis)

  • Electron microscopy to confirm structural integrity

Successful isolation of functionally active ATP synthase with intact a-subunit has been achieved for other bacterial species, including A. baumannii F1-ATPase , and similar strategies could be adapted for Arthrobacter sp.

What spectroscopic methods are most informative for studying the conformation of the a-subunit in Arthrobacter sp. ATP synthase?

Multiple spectroscopic approaches provide complementary information about the a-subunit conformation:

NMR Spectroscopy:

  • Useful for studying dynamic aspects of specific domains or fragments

  • Solution NMR could be applied to soluble portions or detergent-solubilized fragments

  • Solid-state NMR applicable to the membrane-embedded intact a-subunit

  • Can provide information on conformational changes during the catalytic cycle

FTIR Spectroscopy:

  • Useful for monitoring secondary structure content

  • Can detect conformational changes upon protonation/deprotonation

  • Applicable to reconstituted systems

Fluorescence Spectroscopy:

  • Site-specific labeling with fluorescent probes to monitor local conformational changes

  • FRET pairs can measure distances between specific residues

  • Useful for monitoring real-time conformational dynamics

EPR Spectroscopy:

  • Site-directed spin labeling followed by EPR provides information on local environment

  • Double electron-electron resonance (DEER) measures distances between labeled sites

  • Particularly valuable for mapping conformational changes in the membrane domain

Each method provides different insights, and integration of multiple techniques would provide the most comprehensive view of a-subunit conformation and dynamics in Arthrobacter sp. ATP synthase.

How has the a-subunit of ATP synthase evolved within the Actinobacteria phylum?

The evolution of the ATP synthase a-subunit within the Actinobacteria phylum, which includes Arthrobacter sp., reflects adaptations to diverse ecological niches:

Evolutionary Conservation Patterns:

  • Core functional regions (proton channels, c-ring interface) show high conservation

  • Peripheral regions display greater sequence diversity

  • Transmembrane topology (typically 5-6 helices) is preserved across the phylum

Actinobacteria-Specific Features:

  • Actinobacteria like Mycobacterium smegmatis have ATP synthases with 8 types of subunits, differing from other bacterial phyla

  • Specific structural adaptations may include differences in intersubunit interaction interfaces

  • These variations likely reflect adaptations to the distinct cell envelope architecture of Actinobacteria

Comparative Sequence Analysis:
Analysis of key functional residues across Actinobacteria would reveal clade-specific adaptations:

  • Conservation of the essential arginine equivalent to E. coli Arg-210

  • Variability in residues lining the proton half-channels

  • Potential phylum-specific motifs in transmembrane helices

Environmental Adaptation Evidence:

  • Soil-dwelling Actinobacteria like Arthrobacter likely show adaptations for variable pH environments

  • Extremophilic Actinobacteria would have additional specialized adaptations

  • Pathogenic Actinobacteria may have evolved features related to host environment adaptation

Detailed phylogenetic analysis combining sequence data with structural information would illuminate how selective pressures have shaped the evolution of this critical subunit within the Actinobacteria phylum .

What structural differences in the a-subunit contribute to the distinct properties of ATP synthases across different bacterial phyla?

Structural differences in the a-subunit across bacterial phyla contribute significantly to the functional diversity of ATP synthases:

Transmembrane Architecture:

  • While the general topology of 5-6 transmembrane helices is conserved, the specific arrangements differ

  • Helix packing variations affect the geometry of proton pathways

  • Actinobacteria like Mycobacterium have different intersubunit interaction interfaces compared to Firmicutes like Bacillus species

Proton Channel Composition:

  • The residues lining the half-channels vary across phyla

  • These variations affect proton affinity, transfer rates, and pH dependencies

  • In alkaliphiles, specific residues like Lys-180 in B. pseudofirmus OF4 are critical for ATP synthesis at high pH

c-ring Interface Adaptations:

  • The interface between a-subunit and c-ring shows phylum-specific adaptations

  • These differences affect the efficiency of coupling between proton movement and c-ring rotation

  • The precise geometry of this interface is crucial for preventing proton leakage

Peripheral Stalk Interactions:

  • The interface between a-subunit and peripheral stalk components varies across phyla

  • In Actinobacteria, this interface may have specific features compared to other bacterial groups

Structure-Function Relationship Table:

Structural FeatureFirmicutes (e.g., Bacillus)Actinobacteria (e.g., Arthrobacter)Proteobacteria (e.g., E. coli)Functional Implication
Subunit composition9 types of subunits 8 types of subunits 8 types of subunitsAffects assembly and regulation
Critical a-subunit residuesLys-180 in alkaliphiles Phylum-specific adaptationsArg-210Determines pH range for activity
a/b-subunit interfaceMore extensive contactsFewer contacts IntermediateInfluences stator stability
a-subunit/c-ring interfacePhylum-specific geometryDistinct interface architectureWell-characterizedAffects coupling efficiency

These structural differences contribute to the ability of ATP synthases to function optimally in the diverse environments inhabited by different bacterial phyla .

How can structural insights into Arthrobacter sp. ATP synthase a-subunit inform antimicrobial drug development?

Structural insights into Arthrobacter sp. ATP synthase a-subunit could inform antimicrobial drug development in several ways:

Structure-Based Drug Design Approach:

  • High-resolution structures of bacterial ATP synthases provide templates for in silico screening of compound libraries

  • The a-subunit/c-ring interface offers a potential target for disrupting proton translocation

  • Understanding Actinobacteria-specific features of the a-subunit could enable selective targeting

Selectivity Considerations:

  • Structural differences between bacterial and human mitochondrial ATP synthases can be exploited

  • Targeting bacteria-specific elements of the a-subunit could reduce off-target effects

  • The success of bedaquiline (BDQ), which targets mycobacterial ATP synthase c-rings, demonstrates the potential of this approach

Potential Targeting Strategies:

  • Compounds that block the proton channels in the a-subunit

  • Molecules that disrupt the critical a-subunit/c-ring interface

  • Agents that interfere with a-subunit assembly into the ATP synthase complex

Arthrobacter-Specific Considerations:

  • While not typically pathogenic, Arthrobacter sp. is a member of the Actinobacteria phylum

  • Insights from Arthrobacter could be applicable to related pathogenic Actinobacteria

  • Comparative structural analysis could reveal conserved features within the phylum

The F₀F₁-structure-based approach has already shown promise in the development of anti-tuberculosis drugs targeting mycobacterial ATP synthase , and similar strategies could be applied using insights from Arthrobacter sp. ATP synthase structures.

What biotechnological applications could be developed using engineered versions of Arthrobacter sp. ATP synthase a-subunit?

Engineered versions of Arthrobacter sp. ATP synthase a-subunit could enable various biotechnological applications:

Bioenergy Applications:

  • Modified a-subunits with enhanced coupling efficiency could improve ATP production in bioreactors

  • Engineered proton channels with altered specificity could enable the use of alternative ion gradients

  • Hybrid systems combining features from different bacterial phyla might optimize performance under specific conditions

Biosensing Technologies:

  • ATP synthase-based sensors for detecting changes in proton concentration or membrane potential

  • Engineered a-subunits with site-specific reporter groups to monitor conformational changes

  • Integration into artificial membrane systems for portable sensing applications

Nanomotor Development:

  • The rotary mechanism of ATP synthase makes it an attractive template for developing nanomotors

  • Engineered a-subunits could modify the speed, torque, or directional control of these nanomotors

  • Hybrid constructs with synthetic components could expand functionality

Drug Screening Platforms:

  • Reconstituted systems containing engineered a-subunits could serve as platforms for screening potential antimicrobials

  • Mutations introducing sensitivity to specific compounds could create biosensor systems

Protein Engineering Strategies Table:

Engineering ApproachPotential ModificationExpected OutcomeBiotechnological Application
Rational designAlter proton channel residuesModified pH dependencyOperation in non-native conditions
Directed evolutionSelection for increased stabilityEnhanced durabilityLong-term bioenergy applications
Domain swappingReplace regions with counterparts from extremophilesNew environmental tolerancesExpanded operating conditions
Site-specific labelingIntroduction of fluorophores or other reportersReal-time activity monitoringBiosensing applications
Interface modificationsAlter a-subunit/c-ring interfaceModified coupling efficiencyTunable nanomotors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.