Recombinant Arthrobacter sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; Arth_2609; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Arthrobacter sp. (strain FB24)
Target Names
atpF
Target Protein Sequence
MNQTIISAATEGTNPLVPNPWEMGVVLAGFAVLFYIVVKFVVPMFEKTFAERAEAIEGGI AKAEKAQAEASAALEEYKQQLTDARAEANRIREEARAEGAQILADLKEKAAAESARITAH AHAQIESERQAAVVSLRAEVGTLATTLASRIVGESLSDDARAARVVDRFLADLENQNAGA AK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, which houses the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of subunit b (atpF) in bacterial ATP synthase?

Subunit b (atpF) serves as a critical structural component of the ATP synthase stator stalk, connecting the membrane-embedded F₀ sector to the catalytic F₁ sector. In bacterial ATP synthases, two identical b subunits typically form a right-handed coiled-coil dimer that extends from the membrane to interact with the α and δ subunits of the F₁ sector. This structural element prevents rotation of the F₁ sector during catalysis, allowing the enzyme to function as a rotary motor. The b subunit is essential for enzyme assembly and stability, as it maintains the proper spatial relationship between the F₁ and F₀ sectors .

Methodology note: To study b subunit function, researchers often use site-directed mutagenesis to modify key residues, followed by functional assays measuring ATP synthesis or hydrolysis activities. Crosslinking studies can also reveal interactions between the b subunit and other ATP synthase components.

How does the genetic structure of atpF in Arthrobacter sp. compare to other bacterial species?

The atpF gene in Arthrobacter species is typically located within the atp operon, which encodes all subunits of the F₁F₀-ATP synthase. While the general arrangement of ATP synthase genes is conserved across many bacterial species, Arthrobacter spp., as members of Actinobacteria, may show distinct genetic characteristics related to their environmental adaptations .

In bacteria such as E. coli, the atp operon arrangement is atpIBEFHAGDC, where atpF encodes the b subunit. Comparative genomic analyses of Arthrobacter species isolated from extreme environments, particularly cold Antarctic soils, reveal potential adaptations in ATP synthase genes that may contribute to their psychrotolerance and metalotolerance .

What expression systems are most effective for producing recombinant Arthrobacter sp. ATP synthase subunit b?

Expression SystemAdvantagesLimitationsBest Applications
E. coli BL21(DE3)High yield, simple induction, widely availablePotential improper folding of membrane proteinsInitial screening, structural studies requiring high protein amounts
E. coli C41/C43Better for membrane proteins, reduced toxicityLower yield than BL21Functional studies requiring properly folded protein
Cell-free systemsAvoids toxicity issues, rapid productionExpensive, lower yieldRapid screening of variants, toxic proteins
Homologous expressionNative folding and processingComplex development, lower yieldFunctional studies requiring authentic protein

For heterologous expression of the b subunit alone, a strategy similar to that used for Bacillus ATP synthase components can be employed, where recombinant expression in E. coli has been successful . For functional studies, co-expression with other ATP synthase subunits may be necessary to ensure proper complex formation.

How can researchers verify the proper folding and assembly of recombinant atpF?

Verifying proper folding and assembly of recombinant atpF requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure, particularly the α-helical content expected in the b subunit

  • Size-exclusion chromatography to determine oligomeric state (typically dimeric for b subunits)

  • Limited proteolysis to probe structural integrity (properly folded proteins show characteristic digestion patterns)

  • Reconstitution assays with other ATP synthase components to test functional assembly

  • Crosslinking studies to verify interaction with other subunits, especially δ and a subunits

For Arthrobacter sp. b subunit, characteristic resistance to proteolytic digestion when properly assembled into the ATP synthase complex can serve as a useful indicator of correct folding, similar to what has been observed with other bacterial ATP synthases .

How do extremophilic adaptations in Arthrobacter sp. affect atpF structure and function?

Arthrobacter species thrive in extreme environments, including permanently cold Antarctic soils and contaminated sites with high metal concentrations . These environmental pressures likely drive adaptations in the ATP synthase complex, including the b subunit.

In psychrotolerant bacteria, ATP synthase adaptations often include:

  • Increased flexibility in structural regions to maintain function at low temperatures

  • Modified amino acid composition with fewer proline residues in helical regions

  • Enhanced hydrophobic interactions that stabilize subunit interfaces

  • Potential plasmid-encoded regulatory elements that influence ATP synthase expression under stress conditions

For Arthrobacter sp. found in Antarctic environments, the b subunit may contain specific modifications that stabilize its interaction with other subunits under cold conditions while maintaining the flexibility required for enzyme function. Comparative studies with mesophilic counterparts using hydrogen-deuterium exchange mass spectrometry can reveal differences in structural dynamics related to cold adaptation.

What experimental approaches can resolve contradictory data about atpF function in ATP synthase assembly?

Contradictory findings regarding the role of ATP synthase components in complex assembly, including the b subunit, can be addressed through multiple experimental approaches:

  • Complementation studies: Create atpF deletion strains and complement with wild-type or modified b subunits to assess function in vivo. This approach has successfully clarified the role of other ATP synthase components like AtpI .

  • Time-resolved assembly monitoring: Use pulse-chase experiments with fluorescently tagged subunits to track assembly intermediates and determine the temporal sequence of ATP synthase construction.

  • Cryo-electron microscopy of assembly intermediates: Isolate ATP synthase complexes at various assembly stages to visualize the structural role of the b subunit during biogenesis.

  • Crosslinking mass spectrometry: Identify interaction partners of the b subunit throughout assembly to map its contribution to complex formation.

  • Genetic suppressor analysis: Identify mutations that suppress defects in b subunit function to reveal functional relationships with other ATP synthase components.

When contradictory results arise, they often reflect differences in experimental conditions or organisms. For instance, studies in alkaliphilic Bacillus have shown that AtpI, another component encoded in many bacterial atp operons, is not essential for c-ring assembly despite earlier reports indicating otherwise . Similar contradictions might exist for atpF function in different bacterial species.

How can researchers distinguish between direct and indirect effects when studying atpF mutations?

Distinguishing direct from indirect effects of atpF mutations requires a comprehensive experimental design:

This approach has been successfully employed in studies of the ε subunit of ATP synthase, where specific mutations in the C-terminal domain were shown to directly affect ATPase inhibition . Similar strategies can clarify the direct effects of atpF mutations on ATP synthase assembly and function.

What structural adaptations in Arthrobacter sp. atpF contribute to its extremophilic properties?

Understanding structural adaptations in Arthrobacter sp. atpF requires comparative analysis with mesophilic counterparts. Key characteristics to investigate include:

Adaptive FeatureStructural ElementExperimental ApproachExpected Outcome in Extremophiles
Cold stabilityα-helical coiled-coilCD spectroscopy at varying temperaturesMaintained secondary structure at lower temperatures
FlexibilityHinge regionsHydrogen-deuterium exchange MSDifferential exchange patterns at interface regions
Surface chargeExposed residuesElectrostatic mappingModified charge distribution optimized for cold environments
Metal coordinationBinding sitesITC with various metalsAltered metal binding properties related to metalotolerance

These adaptations likely contribute to the remarkable ability of Arthrobacter species to thrive in Antarctic environments and metal-contaminated soils . The b subunit, as a critical component maintaining ATP synthase structure, would be expected to show adaptations supporting enzyme function under extreme conditions.

What purification strategy yields the highest quality recombinant Arthrobacter sp. atpF protein?

A comprehensive purification strategy for recombinant Arthrobacter sp. atpF should address its hydrophobic nature and tendency to form inclusion bodies:

  • Expression optimization:

    • Use lower induction temperatures (16-20°C) to promote proper folding

    • Consider fusion partners like MBP or SUMO to enhance solubility

    • Test autoinduction media to provide gradual protein expression

  • Extraction options:

    • For soluble fractions: Standard lysis in the presence of stabilizing agents

    • For membrane-associated fractions: Mild detergents (DDM, LDAO) shown effective for ATP synthase components

    • For inclusion bodies: Solubilization in 8M urea followed by on-column refolding

  • Chromatography sequence:

    • IMAC (immobilized metal affinity chromatography) using His-tag

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography to isolate properly folded dimeric b subunit

  • Quality control:

    • SDS-PAGE for purity assessment

    • CD spectroscopy to confirm α-helical structure

    • Dynamic light scattering to verify homogeneity

    • Mass spectrometry to confirm identity and detect post-translational modifications

For functional studies, co-purification with other ATP synthase components may be necessary, similar to the approach used for the TA2F₁ complex from Bacillus where intact ATP synthase complexes were purified using a His-tagged β subunit .

How can researchers effectively reconstitute functional ATP synthase using recombinant Arthrobacter sp. atpF?

Reconstitution of functional ATP synthase containing recombinant Arthrobacter sp. atpF requires careful consideration of lipid environment and assembly conditions:

  • Component preparation:

    • Express and purify individual subunits or subcomplexes (F₁ and F₀)

    • Ensure removal of all detergent before reconstitution

    • Verify protein quality through activity assays of individual components

  • Reconstitution method:

    • Detergent-mediated reconstitution into liposomes composed of E. coli lipids or synthetic mixtures

    • Gradual detergent removal using Bio-Beads or dialysis

    • Optimization of protein:lipid ratios for maximum activity

  • Functional verification:

    • ATP synthesis assays using artificially imposed proton gradient

    • ATP hydrolysis activity measurements with colorimetric phosphate detection

    • Proton pumping assays using pH-sensitive fluorescent dyes

  • Structural verification:

    • Negative-stain electron microscopy to confirm complex formation

    • Proteolytic digestion patterns to verify proper assembly

    • Crosslinking studies to confirm subunit interactions

A heterologous reconstitution approach has been successfully used with ATP synthase components from alkaliphilic bacteria, where recombinant F₁ complexes were reconstituted with F₁-stripped native membranes to form functional holoenzymes . This approach could be adapted for Arthrobacter sp. ATP synthase components.

What analytical techniques best characterize the interaction between atpF and other ATP synthase subunits?

Characterizing interactions between atpF and other ATP synthase subunits requires multiple complementary approaches:

  • In vitro interaction studies:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for interactions in solution

    • Pull-down assays with purified components

  • Structural characterization:

    • Crosslinking coupled with mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

    • FRET analysis to measure distances between labeled subunits

    • Electron microscopy of partial complexes to visualize subunit arrangement

  • Functional interaction assessment:

    • Mutational analysis of predicted interaction sites followed by activity assays

    • Disulfide crosslinking to test proximity of specific residues

    • Genetic suppressor screening to identify compensatory mutations

These approaches can reveal how the b subunit interacts with other components, particularly the δ subunit in the F₁ sector and the a subunit in the F₀ sector, which are critical for proper ATP synthase assembly and function .

How can structural studies of Arthrobacter sp. atpF inform biotechnological applications?

Structural studies of Arthrobacter sp. atpF can inform several biotechnological applications:

  • Designer ATP synthases for extreme conditions:

    • Engineering ATP synthases with enhanced stability for industrial biocatalysis

    • Creating hybrid enzymes with properties suited for specific biotechnological processes

    • Developing ATP regeneration systems for cell-free synthetic biology applications

  • Antimicrobial development:

    • ATP synthase is a potential therapeutic target for antimicrobial compounds

    • Understanding structural differences between bacterial and human ATP synthase can guide selective inhibitor design

    • Arthrobacter-specific features could inform narrow-spectrum antimicrobials

  • Biosensor development:

    • ATP synthase components as recognition elements in biosensors for environmental monitoring

    • Detection systems for heavy metals based on interactions with adapted ATP synthase proteins

    • Energy-generating biological interfaces using reconstituted ATP synthase

  • Nanomotor applications:

    • ATP synthase functions as a biological nanomotor

    • Understanding the stator structure (including b subunit) can inform design of synthetic molecular motors

    • Development of hybrid biological-mechanical nanosystems

The remarkable adaptations of Arthrobacter species to extreme conditions, including cold and metal-contaminated environments , make their ATP synthase components particularly valuable for biotechnological applications requiring robust performance under challenging conditions.

What insights can comparative genomic analysis of atpF provide about ATP synthase evolution in extremophiles?

Comparative genomic analysis of atpF across extremophilic bacteria can reveal evolutionary adaptations of ATP synthase:

  • Sequence-structure-function relationships:

    • Identification of conserved motifs specific to extremophilic bacteria

    • Correlation of sequence variations with environmental adaptations

    • Reconstruction of evolutionary trajectories leading to extremophilic properties

  • Horizontal gene transfer assessment:

    • Evaluation of atpF presence on plasmids versus chromosomal location

    • Identification of mobile genetic elements associated with atpF variants

    • Analysis of codon usage patterns to detect recent gene transfers

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify positively selected residues

    • Identification of residues under purifying selection that maintain critical functions

    • Correlation of selection patterns with environmental parameters

Arthrobacter species have been found to contain plasmids carrying various genes that contribute to their environmental adaptations . Although ATP synthase genes are typically chromosomal, comparative analysis could reveal whether horizontal gene transfer has contributed to the evolution of extremophilic adaptations in ATP synthase components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.