Recombinant Arthrobacter sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant HtpX is derived from Arthrobacter sp. strain FB24 (UniProt ID: A0JZI3) and consists of 289 amino acids (1–289aa) fused with an N-terminal His tag for purification . Key features include:

PropertyDescription
Gene LocusArth_3074
Protein ClassZinc metalloprotease (EC 3.4.24.-)
Expression HostE. coli
Molecular Weight~33 kDa (calculated from sequence)
TagN-terminal His tag
Storage Conditions-20°C or -80°C in Tris buffer with 50% glycerol; avoid freeze-thaw cycles

The enzyme shares homology with E. coli HtpX, which exhibits zinc-dependent endoprotease activity against substrates like casein and membrane proteins (e.g., SecY) . Self-degradation occurs upon membrane solubilization, necessitating purification under denaturing conditions followed by refolding with zinc chelators .

Proteolytic Mechanism

  • Zinc dependency: Activity is restored upon Zn²⁺ supplementation, critical for substrate cleavage .

  • Substrate specificity: Degrades solubilized membrane proteins (e.g., SecY) and casein, indicating broad specificity .

  • Structural motifs: Contains conserved domains typical of metalloproteases, including a zinc-binding site and transmembrane helices for membrane association .

Physiological Role

HtpX homologs participate in stress-response pathways, degrading misfolded membrane proteins under thermal or osmotic stress. In Arthrobacter sp., this enzyme likely contributes to adaptation in extreme environments, as suggested by genomic studies of polar Arthrobacter strains .

Research Applications

  1. Membrane protein quality control: Used to study proteolytic regulation of membrane-bound substrates .

  2. Enzyme kinetics: Zinc-dependent activity assays inform metalloprotease catalytic mechanisms .

  3. Structural biology: His tag facilitates crystallization and cryo-EM studies .

Comparative Analysis with Orthologs

While Arthrobacter HtpX remains understudied, insights from E. coli HtpX highlight conserved functional traits:

FeatureArthrobacter HtpXE. coli HtpX
Zinc dependencePresumed (based on homology) Confirmed
Substrate rangeCasein, membrane proteins SecY, misfolded proteins
LocalizationMembrane-associated Integral membrane

Future Directions

  • Structural resolution: High-resolution structures could elucidate substrate-binding motifs.

  • Biotechnological use: Potential in industrial protein degradation systems or antibiotic discovery targeting bacterial proteostasis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Arth_3074; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Arthrobacter sp. (strain FB24)
Target Names
htpX
Target Protein Sequence
MHNHHNGLKTAALFGVLWAVLLGLGAVIGSSMRSTTPIWIMALVGVGTTAYGYWNSDKLA LRSMQAYPVTEEQAPQLYQIVRELSAKANQPMPRIYVSPTPAPNAFATGRNPQNAAVCCT EGILRLLSLRELRGVLGHELMHVYNRDILTSSVAAAVAGVITSVGQMLLIFGGGDRRNSN PLAVMAMALLAPLAAVVIQSAISRTREYDADEDGSALTGDPLALASALRKIHQGVQMVPL PPDQKLVNTSHLMIANPFRAGGVTRMFATHPPMQDRITRLELMAGGPAS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Protease HtpX homolog from Arthrobacter sp. and what are its basic properties?

Protease HtpX homolog from Arthrobacter sp. (strain FB24) is a membrane-integrated metalloprotease classified under EC 3.4.24.- and belongs to the MEROPS family M48 (subfamily M48B) of peptidases. The protein is conserved across bacteria and archaea, suggesting evolutionary importance in cellular processes .

The recombinant protein has the following properties:

  • UniProt accession number: A0JZI3

  • Molecular weight: Approximately 30.9 kDa (based on homologous proteins)

  • Ordered locus name: Arth_3074

  • Expression region: 1-289 (full-length protein)

  • Contains transmembrane domains and a zinc-binding motif characteristic of metalloproteases

How does the structure of Arthrobacter sp. HtpX compare to homologs in other bacterial species?

Comparative analysis reveals that HtpX homologs across bacterial species share conserved structural features while exhibiting species-specific variations:

SpeciesMolecular WeightNotable Structural FeaturesSequence Identity to Arthrobacter sp.
Arthrobacter sp. (FB24)~30.9 kDa4 transmembrane domains, zinc-binding motif100%
Escherichia coli~31.4 kDaMembrane-anchored, cytoplasm-exposed active site~35-40%
Burkholderia pseudomallei30.9 kDaSimilar transmembrane topology~45-50%
Bacillus subtilis (YkrL)~32 kDaSimilar domain organization~30-35%

While the core catalytic domain is highly conserved, variations are primarily observed in the transmembrane regions and substrate-binding domains, reflecting adaptation to different membrane compositions and proteolytic requirements .

What are the optimal storage conditions for recombinant Arthrobacter sp. Protease HtpX homolog?

For optimal stability and activity retention of recombinant Arthrobacter sp. Protease HtpX homolog:

  • Store the stock solution at -20°C

  • For extended storage periods, maintain at -20°C or -80°C

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can significantly compromise protein activity

  • The optimal storage buffer consists of Tris-based buffer with 50% glycerol, specifically optimized for this protein's stability

What expression systems are most effective for producing recombinant Arthrobacter sp. HtpX?

Based on recombinant protein production protocols for membrane proteases similar to HtpX:

Expression SystemAdvantagesLimitationsYield
E. coli BL21(DE3)Cost-effective, rapid growthMay form inclusion bodiesModerate
E. coli C41/C43Engineered for membrane proteinsMore complex induction requirementsHigh
Insect cell systemsBetter folding of complex structuresHigher cost, slower productionHigh
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldLow-moderate

For optimal expression:

  • Use C41/C43 E. coli strains specifically engineered for membrane protein expression

  • Employ lower induction temperatures (16-20°C)

  • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Include membrane-mimetic compounds in the purification buffers

  • Verify protein quality using size-exclusion chromatography to ensure proper folding

What methods are most reliable for assessing the enzymatic activity of recombinant HtpX?

Several methodologies can be employed to assess HtpX protease activity:

  • Fluorogenic peptide substrates:

    • Use peptides with quenched fluorophores that emit signal upon cleavage

    • Advantage: Quantitative and real-time kinetic measurements

    • Recommended substrate: Peptides containing hydrophobic residues at P1 position

  • FRET-based assays:

    • Employ substrate peptides labeled with donor-acceptor fluorophore pairs

    • Allows monitoring of cleavage kinetics in real-time with high sensitivity

  • Proteomic identification of substrate cleavage sites:

    • TAILS (Terminal Amine Isotopic Labeling of Substrates) approach

    • LC-MS/MS analysis of cleaved peptides

  • Cell-based degradation assays:

    • Monitor degradation of tagged potential substrate proteins

    • Particularly useful for establishing physiological relevance

Control experiments should include:

  • Heat-inactivated enzyme controls

  • Metal chelator (EDTA) inhibition assays to confirm metalloprotease activity

  • Substrate specificity comparison with related proteases like FtsH

What is the primary cellular function of HtpX protease homologs in bacterial systems?

HtpX proteases serve critical functions in bacterial membrane protein quality control and stress response mechanisms:

  • Membrane Protein Quality Control:

    • Degradation of misfolded or damaged membrane proteins

    • Collaboration with AAA+ proteases (particularly FtsH) in eliminating defective inner membrane proteins

    • Prevention of proteotoxic stress through timely removal of aberrant proteins

  • Stress Response:

    • Upregulation under membrane protein overproduction stress

    • Enhanced expression during heat shock (hence the "htp" designation)

    • Contribution to cellular resilience during growth arrest

  • Regulated Proteolysis:

    • Selective degradation of specific membrane proteins during adaptation to environmental changes

    • Processing of regulatory proteins involved in envelope stress responses

In B. subtilis, expression of the HtpX homolog (ykrL) is regulated by two proteins: Rok (a repressor of competence) and YkrK (a novel type of regulator), suggesting integration within broader cellular regulatory networks .

How does the mechanism of HtpX differ from other membrane proteases involved in protein quality control?

Comparative analysis reveals distinct mechanistic features of HtpX relative to other membrane proteases:

ProteaseCellular LocationEnergy RequirementSubstrate SpecificityRegulatory Mechanism
HtpXInner membrane, active site facing cytoplasmATP-independentMisfolded membrane proteinsOften regulated by stress response systems
FtsHInner membraneATP-dependentBoth cytoplasmic and membrane proteinsRegulated by adaptor proteins
BepAPeriplasmic side of inner membraneATP-independentβ-barrel outer membrane proteinsDual function: promoting folding or degradation
DegPPeriplasmATP-independentMisfolded periplasmic and outer membrane proteinsTemperature-dependent oligomeric state changes

Unlike the ATP-dependent FtsH, HtpX functions independently of ATP hydrolysis for proteolytic activity, which may be advantageous under energy-limited conditions. While FtsH has a broader substrate range including cytoplasmic proteins, HtpX appears more specialized for membrane protein substrates.

BepA (YfgC) represents an interesting comparison point as it exhibits dual functionality - promoting either the biogenesis or proteolytic elimination of outer membrane proteins depending on their folding state . This differs from HtpX, which primarily functions in degradation rather than folding assistance.

What evidence exists for HtpX involvement in bacterial stress responses?

Multiple lines of evidence support HtpX's role in bacterial stress responses:

  • Transcriptional regulation:

    • In E. coli, htpX is under control of the CpxR/CpxA extracytoplasmic stress response system

    • In B. subtilis, expression of the HtpX homolog (ykrL) is upregulated under membrane protein overproduction stress

  • Genetic interactions:

    • Deletion of both htpX and ftsH in E. coli strain with ftsH suppressor mutation results in thermosensitivity

    • Individual deletions demonstrate complementary functions in dealing with proteotoxic stress

  • Stress survival studies:

    • Heat-shock proteases (including those functioning with HtpX like FtsH) promote survival of Pseudomonas aeruginosa during growth arrest

    • These proteases function hierarchically during stress, with FtsH and ClpXP having primary roles, while HslVU and Lon deploy secondary responses

  • Interactome studies:

    • HtpX physically interacts with components of stress response pathways

    • Associations with proteins involved in envelope stress signaling support its integration in stress response networks

How can site-directed mutagenesis of Arthrobacter sp. HtpX elucidate structure-function relationships?

Site-directed mutagenesis offers powerful insights into HtpX structure-function relationships. Based on homology modeling and sequence analysis, key targets include:

  • Catalytic zinc-binding motif:

    • HEXXH motif is conserved in HtpX metalloproteases

    • Mutations of histidine residues (H→A) would confirm their role in zinc coordination

    • Glutamate mutation (E→Q) would test its proposed role in catalysis

  • Transmembrane domains:

    • Systematic substitutions in transmembrane regions can reveal residues important for substrate recognition

    • Charge-introducing mutations (e.g., L→K) in hydrophobic regions can disturb membrane integration

  • Substrate-binding domains:

    • C-terminal domain mutations can identify regions involved in substrate specificity

    • Conservative substitutions (e.g., Y→F) can elucidate the importance of hydrogen bonding

  • Regulatory regions:

    • N-terminal domain modifications may affect activation mechanisms

    • Mutations at interfaces with potential regulatory proteins could disrupt activity control

The development of a reporter-based activity assay using fluorescent substrate analogs would enable high-throughput screening of mutant libraries to comprehensively map functional regions .

What role might HtpX play in bacterial pathogenesis and antibiotic resistance mechanisms?

Evidence suggests HtpX may contribute to bacterial pathogenesis and antibiotic responses through several mechanisms:

  • Membrane integrity maintenance:

    • HtpX's role in membrane protein quality control may help maintain envelope integrity during host interaction

    • This function would be particularly important under the stress conditions encountered during infection

  • Antibiotic resistance connections:

    • Deletion of genes involved in quality control of membrane proteins (like BepA, which shares functional overlap with HtpX) causes significantly elevated sensitivity to high-molecular weight antibiotics including erythromycin and vancomycin

    • This indicates a potential role in maintaining membrane barrier function against antibiotics

  • Stress adaptation during infection:

    • Heat-shock proteases promote survival of bacteria during growth arrest, which is relevant to persistence during infection

    • The FtsH protease (which works cooperatively with HtpX) is generally required for growth arrest survival of Pseudomonas aeruginosa, an opportunistic pathogen

  • Potential novel therapeutic target:

    • The conservation of HtpX across bacterial species but absence in eukaryotes makes it a potential antibiotic target

    • Inhibition could sensitize bacteria to existing antibiotics by compromising membrane quality control

Research investigating HtpX expression during infection models and deletion phenotypes in pathogenicity assays would further elucidate its role in virulence .

What methodological approaches can be used to identify genuine in vivo substrates of HtpX?

Identifying physiological substrates of HtpX requires integrative approaches:

  • Comparative proteomics:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) comparing wild-type vs. ΔhtpX strains

    • Pulse-chase experiments with radioisotope labeling to track protein turnover

    • Quantitative proteomics of membrane fractions can identify proteins that accumulate in HtpX-deficient cells

  • Substrate trapping approaches:

    • Expression of catalytically inactive HtpX variants (E→Q mutation in the active site)

    • Crosslinking followed by co-immunoprecipitation to capture transient enzyme-substrate complexes

    • BioID proximity labeling using HtpX fused to a promiscuous biotin ligase

  • Genetic interaction screens:

    • Synthetic genetic array analysis to identify genes with interactions suggesting shared pathways

    • Suppressor screens to identify proteins whose overexpression compensates for HtpX deficiency

  • Direct biochemical verification:

    • In vitro reconstitution of proteolysis using purified components

    • Validation of cleavage sites by mass spectrometry

    • Proteomic identification of N-termini generated by HtpX activity (N-terminomics)

A comprehensive substrate identification would involve cellular fractionation to focus on membrane proteins, followed by comparative proteomics between wild-type, ΔhtpX, and complemented strains under various stress conditions .

How can recombinant Arthrobacter sp. HtpX be utilized in directed evolution experiments to engineer proteases with novel specificities?

Directed evolution of HtpX offers opportunities to generate proteases with novel specificities and enhanced properties:

  • Library construction strategies:

    • Error-prone PCR targeting the substrate-binding regions

    • DNA shuffling with homologous proteases from other bacteria

    • Focused saturation mutagenesis of residues lining the active site

  • Selection methodologies:

    • Adaptation of the A2M cap (alpha-2-macroglobulin-based protease capture) system described for serine proteases

    • This system covalently captures active proteases upon cleavage of a bait sequence

    • The selection can be tuned for specificity by modifying the bait sequence

  • Screening approaches:

    • FRET-based high-throughput screening with designed substrate libraries

    • Cell survival assays where protease activity is linked to antibiotic resistance

    • Phage display to link genotype to phenotype in large libraries

  • Computational guidance:

    • Homology modeling and substrate docking to predict beneficial mutations

    • Machine learning approaches trained on successful variants to guide further rounds of evolution

By mapping the specificity-determining regions through SCHEMA-based domain shuffling (as demonstrated for other proteases), researchers could develop HtpX variants with tailored catalytic properties for biotechnological applications like controlled proteolysis in protein purification .

What is known about the evolutionary history of HtpX across different bacterial phyla, and what does this reveal about its functional importance?

Evolutionary analysis of HtpX reveals important insights about its conservation and functional significance:

  • Phylogenetic distribution:

    • HtpX homologs are widely distributed across both bacteria and archaea

    • Present in diverse bacterial phyla including Proteobacteria, Firmicutes, and Actinobacteria

    • Also identified in archaeal genomes, indicating ancient evolutionary origin

  • Sequence conservation patterns:

    • The catalytic domain containing the HEXXH motif shows the highest conservation

    • Transmembrane domains exhibit greater sequence variation while maintaining hydrophobicity profiles

    • C-terminal substrate-binding regions show lineage-specific adaptations

  • Genomic context analysis:

    • In some organisms (like B. subtilis), htpX is encoded adjacent to regulatory genes like ykrK

    • This genomic arrangement suggests co-evolution of the protease with its regulatory machinery

  • Selection pressure analysis:

    • Lower dN/dS ratios in the catalytic domain indicate purifying selection

    • Transmembrane regions show evidence of adaptive evolution in some lineages

    • This pattern suggests functional constraints on catalytic activity with adaptation in substrate recognition

  • Horizontal gene transfer events:

    • Some evidence suggests horizontal acquisition of htpX genes in certain lineages

    • This pattern is consistent with other genes involved in stress response systems

Comparative genomics approaches integrating these evolutionary insights with structural modeling could help predict substrate preferences across different bacterial species and inform the development of species-specific inhibitors .

What are common challenges in working with recombinant HtpX and how can they be addressed?

Researchers working with recombinant HtpX face several technical challenges that can be addressed through specific optimization strategies:

ChallengeCauseSolution
Low expression yieldMembrane protein toxicityUse C41/C43 strains, tight expression control, lower induction temperature
Inclusion body formationImproper foldingCo-express with chaperones, use detergent screening, optimize induction conditions
Loss of activity during purificationDenaturation, aggregationInclude stabilizing agents (glycerol), maintain cold temperature, optimize detergent selection
Inconsistent activity measurementsAssay variabilityDevelop robust activity assays with proper controls, standardize buffer conditions
Difficulty in crystallizationConformational heterogeneityUse nanobodies/antibody fragments as crystallization chaperones, consider lipidic cubic phase methods

For activity retention:

  • Maintain proper zinc concentration in buffers (typically 10-50 μM ZnCl₂)

  • Include reducing agents to maintain cysteine residues (1-5 mM DTT or β-mercaptoethanol)

  • Consider mild detergents like DDM, LMNG, or Amphipol A8-35 for stabilization

  • Avoid chelating agents in buffers that might strip the catalytic zinc ion

What are the implications of HtpX's role in protein quality control for developing novel antimicrobial strategies?

Understanding HtpX's role in protein quality control opens several avenues for antimicrobial development:

  • Direct inhibition strategies:

    • Structure-based design of metalloprotease inhibitors targeting the active site

    • Allosteric inhibitors disrupting substrate binding or conformational changes

    • Peptide mimetics based on natural substrates with modifications to prevent cleavage

  • Combination therapy approaches:

    • HtpX inhibition could sensitize bacteria to antibiotics targeting the cell envelope

    • Evidence from BepA studies shows its deletion increases sensitivity to erythromycin and vancomycin

    • Synergistic effects could be achieved with lower antibiotic doses

  • Stress amplification strategy:

    • Inhibiting multiple proteases involved in protein quality control

    • Simultaneous targeting of HtpX and FtsH would prevent compensatory mechanisms

    • This approach could be particularly effective against persistent bacteria in growth arrest states

  • Target validation experiments:

    • Genetic depletion studies in various pathogens to assess essentiality

    • Animal infection models with HtpX-deficient strains to evaluate virulence impact

    • Screening of clinical isolates for variations in HtpX expression and correlation with antibiotic resistance

The highly conserved nature of HtpX's catalytic domain across bacterial species suggests potential for broad-spectrum activity of inhibitors, while differences in substrate-binding domains might enable species-specific targeting strategies .

What emerging technologies could advance our understanding of HtpX structure and function?

Several cutting-edge technologies show promise for deepening our understanding of HtpX:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structure determination

    • Visualization of HtpX in membrane environments using nanodiscs

    • Potential to capture different conformational states during catalytic cycle

  • Integrative structural biology approaches:

    • Combination of X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry to map intramolecular and substrate interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Advanced live-cell imaging:

    • Super-resolution microscopy to track HtpX localization and dynamics

    • FRET-based sensors to monitor HtpX activity in real-time within living cells

    • Single-molecule tracking to observe HtpX behavior in native membrane environments

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) in wild-type vs. ΔhtpX strains

    • Network analysis to position HtpX within broader stress response systems

    • Machine learning to predict new substrates based on known cleavage patterns

  • CRISPR-based technologies:

    • CRISPRi for fine-tuned repression to study dosage effects

    • CRISPR interference screening to identify genetic interactions

    • Base editing for precise modification of catalytic residues without complete gene deletion

These advanced approaches will help resolve longstanding questions about substrate recognition mechanisms, regulatory interactions, and the coordination of HtpX with other quality control systems .

How might the study of Arthrobacter sp. HtpX contribute to our broader understanding of bacterial stress responses and protein quality control systems?

Research on Arthrobacter sp. HtpX has significant implications for our understanding of bacterial physiology:

  • Integration of quality control networks:

    • HtpX represents one component of interconnected protein quality control systems

    • Understanding its specific role helps map the division of labor between different proteases

    • This provides insight into how bacteria maintain proteostasis under various stress conditions

  • Environmental adaptation mechanisms:

    • Arthrobacter species are known for their exceptional ability to survive in diverse environments

    • HtpX may contribute to this adaptability through maintenance of membrane integrity

    • Comparative studies between Arthrobacter and less adaptable species could reveal critical survival mechanisms

  • Evolution of stress response systems:

    • The conservation of HtpX across bacteria and archaea suggests ancient origins

    • Studying species-specific variations can illuminate how stress response systems evolved

    • This evolutionary perspective helps identify core functions versus specialized adaptations

  • Translational insights:

    • Mechanistic understanding of bacterial proteostasis can inform therapeutic strategies

    • Identification of key vulnerabilities in quality control systems could lead to novel antimicrobial approaches

    • Principles of membrane protein quality control may have parallels in eukaryotic systems

Future research integrating HtpX studies with broader investigations of bacterial stress responses will contribute to a systems-level understanding of how bacteria maintain cellular integrity under challenging conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.