Recombinant Arthrobacter sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

UppP is an integral membrane protein responsible for maintaining UP pools required for:

  • Peptidoglycan synthesis: UP transports precursors like N-acetylglucosamine and N-acetylmuramic acid across the membrane .

  • Cell wall homeostasis: Depletion of UP disrupts lipid II cycling, leading to cell lysis or morphological defects .

  • Antibiotic resistance: UppP activity influences susceptibility to bacitracin, which sequesters UPP .

In Bacillus subtilis, UppP works synergistically with BcrC phosphatase, forming a synthetic lethal pair essential for sporulation and vegetative growth .

Recombinant Production Strategies

While no published data explicitly details Arthrobacter sp. UppP production, analogous systems suggest:

ParameterExample from Related Systems
Host organismKomagataella phaffii (methylotrophic yeast)
PromoterMethanol-inducible AOX1 promoter
Secretion signalSaccharomyces cerevisiae α-factor peptide
YieldUp to 465 U/L (observed for Arthrobacter β-galactosidase)

For Arthrobacter sp. enzymes, secretion systems improve solubility, and codon-optimized genes enhance expression .

Biochemical Properties

Homologous UppP enzymes exhibit:

  • pH optima: Neutral to slightly alkaline (pH 6.0–8.0) .

  • Temperature stability: Activity retained at 20–25°C, with reduced function at extremes .

  • Substrate specificity: Strict preference for UPP; no activity toward unrelated pyrophosphates .

Functional Insights from Mutagenesis

Key structural motifs identified in Escherichia coli UppP include:

  • (E/Q)XXXE motif: Binds Mg²⁺ ions critical for catalysis .

  • PGXSRSXXT motif: Stabilizes the substrate-enzyme complex .

  • Periplasmic histidine residue: Proposed to facilitate proton transfer .

Deletion of uppP in B. subtilis results in:

  • Sporulation defects: <7% sporulation efficiency vs. 30% in wild-type .

  • Cell elongation: Filamentous growth under UPP phosphatase limitation .

Therapeutic and Industrial Relevance

  • Antibiotic targeting: UppP inhibition disrupts cell wall synthesis, making it a potential drug target .

  • Biotechnological applications: Recombinant UppP could optimize glycan synthesis pathways in engineered microbes .

Current Research Gaps

  • Arthrobacter-specific data: Structural and kinetic studies on Arthrobacter sp. UppP remain unreported.

  • Regulatory networks: Interactions with undecaprenol kinase (DgkA) and stress response systems (e.g., σᴹ-dependent CESR) require further exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments default to blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
uppP; Arth_2167; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Arthrobacter sp. (strain FB24)
Target Names
uppP
Target Protein Sequence
MLHDVGSINVNWFEAALLGLVQGLTEFLPISSSAHLRIVGSFLPNAADPGAAFTAITQLG TETAVIVYFWRDIVRIVKAWAGTLTRRVPTDDPDARMGWLVILGSLPIIVLGLIFQDQIE SVLRSLWIVATMLIVFGLILAVADAVGRQERELTRLTYKHGIFYGFAQAMALIPGVSRSG GTITAGLLMGYTREAAARYSFLLAIPAVFGSGLYQLYKVMSKDGITGPYGLPETALATLI AFVVGYVIIGWFLKFVSTRSYRLFVWYRIFLGLALYLLLGFNVISA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.