Recombinant Arthrobacter sp. UPF0060 membrane protein Arth_4238 (Arth_4238)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Arth_4238; UPF0060 membrane protein Arth_4238
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Arthrobacter sp. (strain FB24)
Target Names
Arth_4238
Target Protein Sequence
MTIAKTILLFVLAAAAEIGGAWLVWQAVREGKEWWWAGLGVLALGVYGFAATLQPDAHFG RILAAYGGVFVAGSLAWGMVFDGFRPDRWDIIGSVICLLGVAVIMFAPRNAG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing Arth_4238?

E. coli is the predominant expression system for Arth_4238 recombinant production. The methodological approach involves:

  • Cloning the full-length coding sequence (1-112 amino acids) into an appropriate expression vector containing an N-terminal His-tag

  • Transforming the construct into competent E. coli cells

  • Inducing expression under optimized conditions

  • Harvesting cells and lysing to release the protein

  • Purifying via affinity chromatography using the His-tag

Expression yields of greater than 90% purity are achievable as determined by SDS-PAGE analysis .

How should Arth_4238 be stored and reconstituted for experimental use?

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Create working aliquots and store at -20°C/-80°C

What methods are recommended for studying the membrane topology of Arth_4238?

Based on research methodologies for membrane proteins, several approaches can be employed to study Arth_4238 topology:

Real-time FRET Analysis:

  • Label specific residues with fluorescent donor/acceptor pairs

  • Monitor FRET changes during membrane insertion

  • Establish distance relationships between labeled positions and membrane interfaces

Protease Protection Assays:

  • Expose protein-membrane complexes to proteases

  • Analyze protected fragments to determine membrane-embedded regions

  • Use mass spectrometry to identify precise cleavage sites

Charge Substitution Analysis:

  • Introduce charge reversals at key positions

  • Examine effects on membrane orientation and insertion

  • Particularly effective at N-terminal regions to test topological determinants

A combination of these approaches provides complementary data about the protein's arrangement within membranes and can reveal functional determinants of topology.

How can I design a data table to track Arth_4238 membrane insertion experiments?

An effective data table for membrane insertion experiments should include independent and dependent variables with appropriate controls. Below is a template based on methodology principles for membrane protein research:

Table 1: Template for Tracking Arth_4238 Membrane Insertion Experiments

Construct Length (aa)Trial 1 FRET Efficiency (%)Trial 2 FRET Efficiency (%)Trial 3 FRET Efficiency (%)Average FRET Efficiency (%)Insertion State
Arth_4238-35
Arth_4238-50
Arth_4238-65
Arth_4238-75
Arth_4238-94
Arth_4238-112

This table design follows scientific data presentation principles with the independent variable (construct length) in the leftmost column and dependent variables (FRET efficiency measurements and derived state) in subsequent columns2 .

How does Arth_4238 compare structurally to other bacterial membrane proteins?

Structural comparison of Arth_4238 with other bacterial membrane proteins reveals several notable patterns:

  • Like bacteriorhodopsin, Arth_4238 follows the multipass transmembrane protein architecture, though with fewer predicted transmembrane segments

  • Unlike many bacterial transporters with 10-12 transmembrane segments (such as SecY), Arth_4238 has a simpler topology

  • The protein lacks identifiable signal sequences common to secreted proteins, suggesting it uses an alternative insertion mechanism

  • Its sequence lacks the conserved domains found in characterized transporters or channels, indicating it may perform a specialized or as-yet uncharacterized function

Methodologically, structural comparison can be conducted using:

  • Transmembrane prediction algorithms

  • Hydropathy plot analysis

  • Sequence alignment with UPF0060 family members

  • Homology modeling based on solved structures of membrane proteins

What approaches can be used to investigate the potential function of Arth_4238?

As an uncharacterized UPF0060 family member, determining Arth_4238's function requires multiple complementary approaches:

Genetic Context Analysis:

  • Examine genomic neighborhood in Arthrobacter sp.

  • Identify co-regulated genes that may indicate functional relationships

  • Compare with operonic structures in related species

Interactome Mapping:

  • Perform pull-down assays using His-tagged protein

  • Identify binding partners through mass spectrometry

  • Validate interactions through co-immunoprecipitation or FRET analysis

Knockout/Complementation Studies:

  • Generate Arthrobacter sp. strains lacking Arth_4238

  • Assess phenotypic changes under various conditions

  • Complement with wild-type or mutant variants to confirm specificity of effects

Incorporation into Artificial Membranes:

  • Reconstitute purified protein into liposomes

  • Measure ion/solute flux across membranes

  • Test for channel or transporter activity with various substrates

How can the ESCRT-dependent membrane protein degradation pathway be studied using Arth_4238 as a model?

Research on membrane protein degradation pathways can use Arth_4238 as a model system through the following methodological approaches:

  • Cycloheximide Chase Assays:

    • Treat cells expressing Arth_4238 with cycloheximide to inhibit protein synthesis

    • Collect samples at defined time points

    • Analyze protein levels via western blotting to determine half-life

  • Ubiquitination Analysis:

    • Generate lysine mutants of Arth_4238

    • Perform co-immunoprecipitation with ubiquitin antibodies

    • Analyze ubiquitination patterns via western blotting

  • ESCRT Component Knockdown:

    • Use siRNA to target ESCRT components (e.g., CHMP4A, CHMP4B)

    • Monitor effects on Arth_4238 degradation kinetics

    • Visualize membrane localization using fluorescence microscopy

  • Flow Cytometry Quantification:

    • Express GFP-tagged Arth_4238

    • Measure fluorescence intensity over time

    • Compare degradation rates in wild-type vs. ESCRT-depleted conditions

This multi-faceted approach can reveal the regulatory mechanisms controlling membrane protein turnover and establish Arth_4238 as a model substrate for studying membrane protein quality control.

What are the strategies for investigating the electrostatic interactions that may influence Arth_4238 membrane insertion and orientation?

Investigation of electrostatic determinants of Arth_4238 membrane topology requires systematic experimental approaches:

Charge Mapping and Mutagenesis:

  • Analyze distribution of charged residues in Arth_4238 sequence

  • Generate variants with altered charge distribution, particularly at the N-terminus

  • Compare membrane insertion kinetics and final topology between wild-type and mutant constructs

Ribosome Tunnel Interaction Analysis:

  • Design constructs with varying nascent chain lengths

  • Measure FRET between nascent chain and ribosome tunnel components

  • Determine the role of electrostatic interactions in nascent chain retention and inversion

Membrane Potential Manipulation:

  • Reconstitute protein insertion in membrane systems with controlled potential

  • Vary ionic conditions to modify electrostatic environment

  • Determine how membrane potential affects insertion orientation

Table 2: Effects of N-terminal Charge Modifications on Arth_4238 Membrane Insertion

ConstructN-terminal ChargeInsertion Delay (aa)Final TopologyInsertion Efficiency (%)
Wild-type Arth_4238PositiveBaselineN-in100
Charge-reversed Arth_4238NegativeReducedN-outTo be determined
Charge-neutralized Arth_4238NeutralTo be determinedTo be determinedTo be determined

This experimental design directly tests the "positive-inside rule" and examines how electrostatic interactions guide membrane protein topogenesis .

How can advanced genomic analysis techniques be applied to understand the evolutionary context of Arth_4238?

Comprehensive genomic analysis of Arth_4238 can reveal evolutionary patterns and functional constraints through these methodological approaches:

Comparative Genomic Analysis:

  • Identify homologs across bacterial phyla using BLASTp and HMM searches

  • Construct phylogenetic trees of UPF0060 family members

  • Map sequence conservation patterns to predict functional domains

  • Examine synteny of surrounding genomic regions

Analysis of Selection Pressure:

  • Calculate dN/dS ratios across sequence alignments

  • Identify regions under purifying or positive selection

  • Correlate conservation patterns with predicted structural features

Domain Architecture Analysis:

  • Compare domain organization with characterized membrane proteins

  • Identify potential fusion events or domain acquisitions

  • Trace evolutionary history of the UPF0060 family

Research has shown that Arthrobacter sp. forms a separate branch within the Arthrobacter genus, potentially constituting a new species. This evolutionary distinctiveness may extend to its membrane proteins including Arth_4238, providing insights into how membrane protein families evolve across bacterial lineages .

How can Arth_4238 be used as a model system for studying bacterial membrane protein insertion mechanisms?

Arth_4238 offers several advantages as a model system for studying membrane protein biogenesis:

Methodological Approach for Using Arth_4238 as a Model System:

  • In vitro Translation and Insertion Assays:

    • Program ribosomes with Arth_4238 mRNA

    • Monitor co-translational insertion using fluorescence reporters

    • Measure kinetics of membrane targeting and insertion

  • Investigation of Translocon Interactions:

    • Create crosslinking-capable Arth_4238 variants

    • Identify interaction partners during membrane insertion

    • Map the path of the nascent chain through the SecY translocon

  • Topological Determinant Mapping:

    • Generate chimeric constructs with other membrane proteins

    • Determine which segments dictate topological orientation

    • Develop predictive models for membrane protein topogenesis

The relatively small size (112 amino acids) and straightforward structure of Arth_4238 make it particularly suitable as a model system, potentially revealing fundamental principles applicable to more complex membrane proteins.

What methodological approaches should be considered when designing research questions about Arth_4238?

Effective research on Arth_4238 requires careful methodological consideration throughout the research process:

Research Question Development Framework:

  • Begin with clear, focused questions:

    • "How does the topology of Arth_4238 compare to characterized UPF0060 family members?"

    • "What role do specific amino acid residues play in Arth_4238 membrane insertion?"

    • "How does Arth_4238 contribute to Arthrobacter sp. membrane biology?"

  • Ensure appropriate scope:

    • Avoid questions too broad ("What is the function of Arth_4238?")

    • Avoid questions too narrow ("Does mutation Y45A affect expression?")

    • Focus on questions that contribute to membrane protein biology broadly

  • Consider analytical rather than descriptive questions:

    • "What mechanisms determine Arth_4238 membrane orientation?" rather than "What is the orientation of Arth_4238?"

    • "How do membrane properties influence Arth_4238 function?" rather than "Where is Arth_4238 located?"

  • Ensure methodological feasibility:

    • Verify that necessary techniques are accessible

    • Consider time and resource constraints

    • Plan for appropriate controls and statistical analysis

Following these methodological principles ensures research on Arth_4238 will generate meaningful contributions to understanding bacterial membrane protein biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.