Recombinant Arthrobacter sp. UPF0060 membrane protein Arth_4423 (Arth_4423)

What is Arth_4423 and what organism does it originate from?

Arth_4423 is a UPF0060 membrane protein derived from Arthrobacter sp. (strain FB24). The protein belongs to a family of uncharacterized proteins found in various bacterial species. The full-length protein consists of 113 amino acids with a molecular structure characteristic of integral membrane proteins . Arthrobacter species are Gram-positive, aerobic bacteria commonly found in soil environments and known for their unique metabolic capabilities and environmental adaptability .

What is the complete amino acid sequence of Arth_4423?

The complete amino acid sequence of Arth_4423 (1-113) is:
MTIAKSVLLFILAAVAEIGGAWLVWQAVREGRAWWWAGLGIIALGLYGFVATLQPDAHFGRILAAYGGVFVAGSLVWGMVFDGFRPDRWDVIGSVICLVGVAVIMFAPRGTTS

Analysis of this sequence reveals characteristic features of membrane proteins, including hydrophobic regions that likely form transmembrane domains, consistent with its classification as a membrane protein. Sequence analysis tools can further identify potential functional motifs and secondary structure elements important for experimental design considerations.

What are the recommended storage conditions for recombinant Arth_4423?

For optimal stability and activity of recombinant Arth_4423, the following storage conditions are recommended:

The protein is typically provided as either a lyophilized powder or in a stabilized buffer solution . When reconstituting lyophilized protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for improved stability during long-term storage .

What expression systems are most effective for producing recombinant Arth_4423?

While several expression systems can be utilized for recombinant membrane protein production, E. coli remains the most commonly employed host for Arth_4423 expression. The protein is typically expressed with an N-terminal His tag to facilitate purification . For optimal expression, specialized E. coli strains with modifications to reduce competition from endogenous membrane proteins can significantly improve yields.

Engineered E. coli strains such as the BL21ΔABCF variant (which has deletions of four genes encoding abundant β-barrel proteins: OmpA, OmpC, OmpF, and LamB) have shown significantly improved expression of outer membrane proteins compared to standard BL21(DE3) strains . This improvement occurs because the deletion of abundant native membrane proteins reduces competition for membrane insertion machinery, allowing more efficient incorporation of the recombinant target protein.

How can I verify successful expression of Arth_4423 in bacterial systems?

Multiple complementary methods can be employed to verify successful expression:

• SDS-PAGE analysis: Visualize the expressed protein band at the expected molecular weight (~12-15 kDa including the His tag) using Coomassie staining .

• Western blotting: Use anti-His antibodies to specifically detect the tagged recombinant protein, providing greater sensitivity than SDS-PAGE alone .

• Whole-cell ELISA: Particularly useful for quantitative assessment of properly inserted membrane proteins that present epitopes on the cell surface. This method allows comparison of expression levels between different strains and conditions .

• Colony PCR verification: While not directly confirming protein expression, PCR verification using primers specific for the inserted gene can confirm successful transformation prior to expression induction .

When comparing expression levels between different strains, standardization based on equivalent OD600 measurements ensures proper normalization of results .

What purification strategy yields the highest purity of recombinant Arth_4423?

A multi-step purification strategy typically yields the highest purity for recombinant Arth_4423:

• Cell lysis and membrane fraction isolation: Carefully separate membrane fractions through differential centrifugation after cell disruption.

• Membrane protein solubilization: Use appropriate detergents that effectively solubilize the membrane while maintaining protein structural integrity.

• Immobilized metal affinity chromatography (IMAC): Utilize the N-terminal His tag for initial capture purification, typically using Ni-NTA resin .

• Size exclusion chromatography: Further purify the protein and remove aggregates while simultaneously performing buffer exchange.

The final purified protein should demonstrate >90% purity as determined by SDS-PAGE analysis . Throughout purification, it is essential to maintain appropriate detergent concentrations above their critical micelle concentration (CMC) to prevent protein aggregation.

What structural characteristics define Arth_4423 as a membrane protein?

Analysis of the Arth_4423 sequence reveals typical features of bacterial membrane proteins:

Experimental approaches such as protease accessibility assays, cysteine scanning mutagenesis, or epitope insertion coupled with immunofluorescence can be employed to experimentally determine the membrane topology of Arth_4423.

How do expression conditions affect the structural integrity of Arth_4423?

Expression conditions significantly impact the structural integrity and functional state of membrane proteins like Arth_4423. Key parameters include:

To maintain structural integrity during purification, detergent selection is crucial. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) often preserve native-like structure better than harsh detergents such as SDS .

What biophysical techniques are most informative for studying Arth_4423 structure?

Several complementary biophysical techniques provide insights into Arth_4423 structure:

• Circular Dichroism (CD) Spectroscopy: Assesses secondary structure content (α-helices, β-sheets) and can monitor thermal stability.

• Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): Determines oligomeric state and homogeneity in detergent solution.

• Cryo-Electron Microscopy: Potentially resolves high-resolution structural details without crystallization.

• Solid-State NMR: Particularly useful for membrane proteins, providing atomic-level structural information.

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps solvent-accessible regions and can identify flexible domains.

Each technique provides complementary information, and a multi-method approach typically yields the most comprehensive structural characterization.

How can mutational analysis be applied to study structure-function relationships in Arth_4423?

Systematic mutational analysis represents a powerful approach to investigate structure-function relationships in Arth_4423. Key methodological considerations include:

• Alanine scanning mutagenesis: Systematically replace individual residues with alanine to identify functionally important amino acids without substantially disrupting structure.

• Cysteine substitution followed by labeling: Introduce single cysteines at specific positions for subsequent labeling with fluorescent or spin-labeled probes to measure distances or accessibility.

• Domain swapping: Exchange homologous domains between related proteins to identify regions responsible for specific functions.

• Truncation analysis: Create series of N- or C-terminal truncations to map minimal functional domains.

After generating mutants, expression levels can be quantitatively compared using whole-cell ELISA or western blotting techniques to ensure that expression differences don't confound functional analyses . Specialized E. coli strains with reduced expression of endogenous membrane proteins (such as BL21ΔABCF) can significantly improve the signal-to-noise ratio in these experiments .

What approaches can be used to investigate Arth_4423 interactions with other proteins or membrane components?

Several complementary techniques can investigate protein-protein and protein-lipid interactions:

• Co-immunoprecipitation: Pull down Arth_4423 using its His tag and identify co-precipitating binding partners by mass spectrometry.

• Cross-linking coupled with mass spectrometry: Use chemical cross-linkers to capture transient interactions followed by mass spectrometric identification.

• Förster Resonance Energy Transfer (FRET): Label Arth_4423 and potential interaction partners with appropriate fluorophore pairs to detect proximity-dependent energy transfer.

• Biolayer Interferometry or Surface Plasmon Resonance: Quantitatively measure binding kinetics between Arth_4423 and putative interaction partners.

• Lipidomic analysis: Investigate preferential associations between Arth_4423 and specific membrane lipids using mass spectrometry-based lipidomics.

For in vivo studies, bacterial two-hybrid systems adapted for membrane proteins can provide evidence of interactions within the cellular environment .

How can I optimize membrane protein crystallization trials for structure determination of Arth_4423?

Membrane protein crystallization remains challenging but can be systematically approached:

• Construct optimization: Create multiple constructs with varying N- and C-terminal boundaries to identify the most stable and homogeneous version.

• Detergent screening: Test a diverse panel of detergents including maltosides, glucosides, and newer amphipathic polymers like amphipols or nanodiscs.

• Lipid supplementation: Add specific lipids that may stabilize the protein in its native conformation.

• Crystallization screens: Use specialized membrane protein crystallization screens with a focus on conditions that accommodate detergent micelles.

• Protein engineering approaches: Consider adding fusion partners (e.g., T4 lysozyme, BRIL) that can provide additional crystal contacts or removing flexible regions that hinder crystallization.

• Antibody fragment co-crystallization: Generate and purify antibody fragments (Fabs) that bind specifically to Arth_4423 to provide additional crystal contact points.

Optimization requires iterative screening with systematic variation of protein concentration, temperature, precipitants, and additives. High-throughput crystallization facilities can significantly accelerate this process.

How can I address issues with low expression yields of Arth_4423?

Low expression yields can be addressed through systematic optimization:

Studies with other membrane proteins have demonstrated that specialized E. coli strains with knock-outs of abundant outer membrane proteins can significantly improve expression of recombinant membrane proteins, with the quadruple knock-out strain (BL21ΔABCF) often showing the best performance .

What strategies can overcome protein aggregation during purification of Arth_4423?

Membrane protein aggregation during purification can be addressed through several approaches:

• Optimize detergent selection: Test various detergents systematically; consider detergent screens to identify optimal solubilization conditions.

• Implement temperature control: Maintain samples at 4°C throughout purification to reduce thermal denaturation.

• Add stabilizing agents: Include glycerol (5-10%), specific lipids, or stabilizing compounds like cholesteryl hemisuccinate.

• Optimize buffer conditions: Screen various pH conditions, salt concentrations, and buffer types to identify stabilizing conditions.

• Consider mild solubilization: Use partial solubilization approaches that maintain native lipid interactions.

• Employ size exclusion chromatography: As both a purification step and quality control method to remove aggregates and assess homogeneity.

For particularly problematic proteins, newer technologies like SMALPs (Styrene Maleic Acid Lipid Particles) or nanodiscs can extract membrane proteins with their native lipid environment intact .

How can I verify proper membrane insertion and folding of recombinant Arth_4423?

Several complementary techniques can verify proper membrane insertion and folding:

• Membrane fractionation: Confirm localization to the membrane fraction through cellular fractionation and western blotting.

• Protease accessibility assays: Surface-exposed loops should be sensitive to protease digestion while transmembrane regions remain protected.

• Whole-cell ELISA: For constructs with epitope tags in extracellular loops, whole-cell ELISA can confirm proper membrane insertion and orientation .

• Circular dichroism spectroscopy: Compare the secondary structure profile with theoretical predictions for properly folded protein.

• Thermal stability assays: Properly folded membrane proteins typically display cooperative unfolding transitions.

• Functional assays: If the function is known, activity assays provide the most definitive evidence of proper folding.

Quantitative comparisons between different expression conditions can be performed using whole-cell ELISA, which has the advantage of specifically detecting properly inserted membrane proteins that present epitopes on the cell surface .