Recombinant Arthroderma gypseum Bifunctional lycopene cyclase/phytoene synthase (MGYG_02096)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized in E. coli systems, ensuring high yield and purity :

  • Expression System: E. coli (optimized codon usage for heterologous expression).

  • Purification: Immobilized metal affinity chromatography (IMAC) via N-terminal His tag .

  • Purity: >90% verified by SDS-PAGE .

  • Formulation: Lyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose for stability .

Key Findings:

  • The bifunctionality is evolutionarily conserved in fungi, enabling metabolic efficiency .

  • The N-terminal cyclase domain operates independently, while the synthase domain requires structural support from the cyclase region for activity .

  • Enzyme kinetics studies reveal optimal activity at pH 7.5–8.5 and 25–37°C .

Applications in Research and Industry

ApplicationUse Case
Metabolic EngineeringEngineering microbial systems (e.g., E. coli, yeast) for β-carotene production .
Fungal Pathogenesis StudiesInvestigating carotenoid roles in A. gypseum survival under oxidative stress .
Enzyme Mechanism StudiesStructure-function analysis of bifunctional domains via mutagenesis .
Industrial BiotechnologyPotential use in nutraceutical or pigment production due to high catalytic efficiency .

Comparative Analysis with Homologs

MGYG_02096 shares functional parallels with fungal homologs but exhibits unique traits:

OrganismGeneKey Differences
Mucor circinelloidescarRPSimilar bifunctionality but distinct domain architecture .
Aspergillus nigerAn07g00800Lacks cyclase activity; monofunctional phytoene synthase .
Podospora anserinaPODANSg3995Divergent substrate specificity; prefers neurosporene over lycopene .

Quality Control and Validation

  • Activity Assays: Validated via HPLC quantification of β-carotene and phytoene .

  • Endotoxin Levels: <1.0 EU/μg (tested using LAL assay).

  • Stability: Retains >80% activity after 6 months at -80°C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preferred format when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
MGYG_02096; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-594
Protein Length
full length protein
Species
Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum)
Target Names
MGYG_02096
Target Protein Sequence
MGLDYLMVHVKYNLPPALLLTILYKPFFTRLEVHKIVLLCTIAVVWTIPWDSYLIRTRIW SYPADSVLGQTLFQIPLEEVFFFIIQTYNTSLLYIIFNKRLVLPSYLSGPTKPLAQGLFG PITHRTQRDLGTLFFTGILILGISFIYIGGEYMYLGLILSWVSPILVMQWVLMYRFLLAL PPASVWVPIALPTLYLWVVDTLALRRGTWVIESGTKVDIQLWEGLEIEEALFFLVTNVMV VFGIAAMHNAAALFEYKAFISTTAMGDTPSIYQLITLFLTSSRLYDTNVLQEMSQAVTLL KQKSQSMYLGSAMFEGQLRLDLIALYSFCRKADDLIDDAPDRETAKYWIEQCEKALELRF KLKETALDDTEAYQLLTKSIPQPLHAAAHLLPASRLPKEPLSCLLQGFEIDLKFDFEKGS FPIATEHDLEVYAYHVAGTVASLLLELVFRHHPVSISEAERLRVISAGEVMGRALQYTNI ARDITRDAEIGRVYIPSSWLAEEGLTPSMVISHPRNSKLIPLRRRILEKADKCYCETQEA ISKLPSNVQGPVRATVTAYMEIGQVIRENETKIWNGKLKVSRWRRFKRAWLAML
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Database Links
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the domain organization of Recombinant Arthroderma gypseum Bifunctional lycopene cyclase/phytoene synthase?

Based on comparative analysis with similar fungal bifunctional enzymes, the MGYG_02096 protein contains two distinct functional domains: the N-terminal domain corresponds to lycopene cyclase activity (R domain) and the C-terminal domain to phytoene synthase activity (P domain). This bifunctional arrangement is characteristic of certain fungi, whereas in most other organisms, these activities are performed by separate enzymes . The protein consists of 594 amino acids with a complete sequence that includes multiple transmembrane regions and conserved catalytic sites essential for both enzymatic functions .

What expression system yields optimal results for Recombinant MGYG_02096 production?

For laboratory-scale production of functionally active MGYG_02096, E. coli expression systems have proven effective. The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification . When designing expression constructs, researchers should consider:

ParameterRecommended ApproachRationale
Expression vectorpET series with T7 promoterHigh-level inducible expression
E. coli strainBL21(DE3) or Rosetta(DE3)Enhanced expression of proteins with rare codons
Induction conditions0.5-1.0 mM IPTG, 18-25°C, 16-20 hoursLower temperatures reduce inclusion body formation
Codon optimizationRecommendedImproves expression by addressing codon bias issues

Membrane-associated proteins like MGYG_02096 often present expression challenges due to their hydrophobic regions. Analysis of the protein sequence for rare codons and secondary structure prediction is essential for optimizing expression conditions .

What purification strategy ensures highest activity retention for this bifunctional enzyme?

A multi-step purification approach is recommended to obtain high-purity MGYG_02096 while maintaining both enzymatic activities:

  • Initial capture using Ni-NTA affinity chromatography with a controlled imidazole gradient (20-250 mM) to separate full-length protein from truncated products .

  • Size exclusion chromatography to remove aggregates and ensure proper folding.

  • Final polishing step using ion-exchange chromatography if higher purity is required.

Critical considerations during purification include:

  • Maintaining reducing conditions throughout purification (2-5 mM β-mercaptoethanol or DTT)

  • Including glycerol (10-20%) in all buffers to stabilize membrane-associated domains

  • Keeping temperature at 4°C during all purification steps

  • Using mild detergents (0.05-0.1% n-dodecyl-β-D-maltoside) to maintain proper folding of transmembrane regions .

How should researchers properly store and reconstitute MGYG_02096 to maintain dual enzymatic activities?

Proper storage and reconstitution procedures are essential for preserving both lycopene cyclase and phytoene synthase activities:

For long-term storage:

  • Store the lyophilized protein at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles that lead to denaturation

  • Aliquot the protein solution before freezing

For reconstitution:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for samples stored at -20°C

  • Use Tris/PBS-based buffer (pH 8.0) with 6% trehalose as a stabilizing agent

Activity assays should be performed immediately after reconstitution to confirm retention of both enzymatic functions, as the lycopene cyclase activity (N-terminal domain) may be more susceptible to denaturation than the phytoene synthase activity (C-terminal domain) .

How can researchers independently measure the two enzymatic activities of MGYG_02096?

Distinct analytical methods are required to evaluate the dual functionality of MGYG_02096:

Phytoene synthase activity measurement:

  • In vitro assay using purified enzyme with GGPP substrate

  • Incubation in buffer containing Mg²⁺ (essential cofactor)

  • Product detection by HPLC with photodiode array detection at 286 nm (characteristic absorption for phytoene)

  • Quantification against phytoene standards

Lycopene cyclase activity measurement:

  • In vitro conversion of lycopene to β-carotene

  • Spectrophotometric analysis at 450-500 nm range

  • HPLC separation with detection at 450 nm

  • LC-MS analysis for definitive product identification

For comprehensive characterization, a coupled enzyme assay may be designed where both activities can be measured sequentially, monitoring the conversion of GGPP to phytoene and subsequently to cyclic carotenoids .

What factors influence domain interdependence in bifunctional enzymes like MGYG_02096?

Research on similar bifunctional enzymes from Mucor circinelloides has demonstrated a complex domain interdependence pattern that likely applies to MGYG_02096:

DomainFunctional IndependenceStructural Requirements
R domain (lycopene cyclase)Can function independentlyMaintains activity when isolated
P domain (phytoene synthase)Dependent on R domainRequires proper R domain conformation for activity

This asymmetric dependence appears to be a conserved feature in fungal bifunctional carotenoid enzymes. Experimental evidence suggests that the P domain requires structural cues from the properly folded R domain to maintain its active conformation, while the R domain can function autonomously . This has significant implications for protein engineering efforts and fragment-based functional studies.

How does MGYG_02096 compare structurally and functionally to bifunctional enzymes in other fungal species?

Comparative analysis between A. gypseum MGYG_02096 and the well-characterized M. circinelloides carRP gene product reveals key similarities and differences:

FeatureA. gypseum MGYG_02096M. circinelloides carRPSignificance
Protein length594 amino acidsSimilar lengthConserved domain architecture
Domain organizationN-terminal cyclase, C-terminal synthaseSame arrangementEvolutionarily conserved design
Membrane associationMultiple transmembrane regionsSimilar membrane topologyConsistent subcellular localization
Genomic contextUnknown from available dataAdjacent to phytoene dehydrogenase genePotential for coordinated expression
Regulatory elementsNot specifically identifiedBlue-light responsive elementsPossible shared regulatory mechanisms

The bifunctional arrangement represents an evolutionary adaptation specific to fungi, as most other organisms encode these functions in separate proteins. This fusion likely provides coordinated expression and improved catalytic efficiency through substrate channeling .

What methodological approaches can resolve the three-dimensional structure of MGYG_02096?

Determining the three-dimensional structure of membrane-associated bifunctional enzymes like MGYG_02096 presents significant challenges. A multi-technique approach is recommended:

  • X-ray crystallography:

    • Express protein with surface entropy reduction mutations to enhance crystallization

    • Use lipidic cubic phase crystallization for membrane protein regions

    • Consider crystallizing individual domains separately if full-length protein resists crystallization

  • Cryo-electron microscopy:

    • Particularly suitable for membrane proteins resistant to crystallization

    • May reveal domain arrangement and conformational states

  • Computational modeling:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to predict domain interactions and substrate binding

  • Hydrogen-deuterium exchange mass spectrometry:

    • Provides information on protein dynamics and solvent accessibility

    • Can identify interdomain contacts and conformational changes upon substrate binding

These approaches should be considered complementary rather than mutually exclusive, as each provides different structural insights .

How can MGYG_02096 be utilized in metabolic engineering of carotenoid biosynthesis pathways?

The bifunctional nature of MGYG_02096 offers unique advantages for metabolic engineering applications:

  • Simplified genetic engineering: Expression of a single gene provides two enzymatic activities, reducing the complexity of pathway engineering.

  • Enhanced pathway flux: The physical proximity of two sequential enzymatic activities may facilitate substrate channeling, potentially increasing pathway efficiency.

  • Balanced enzyme stoichiometry: The 1:1 ratio of activities prevents metabolic bottlenecks that might occur when expressing separate enzymes at different levels.

  • Applications in heterologous hosts:

    • Engineering β-carotene production in E. coli

    • Enhancing carotenoid content in yeast

    • Modifying carotenoid profiles in plants

When designing metabolic engineering experiments, researchers should consider codon optimization for the target host and evaluate potential rate-limiting steps in the engineered pathway .

What experimental design best evaluates the interdomain communication in MGYG_02096?

To investigate the structural and functional relationships between the two domains of MGYG_02096, a systematic experimental approach is recommended:

  • Domain truncation analysis:

    • Generate constructs expressing only the N-terminal (R) domain

    • Generate constructs expressing only the C-terminal (P) domain

    • Create chimeric proteins with domains from related enzymes

  • Site-directed mutagenesis:

    • Target conserved residues at the domain interface

    • Introduce mutations in catalytic sites of each domain separately

    • Create disulfide bridges to restrict interdomain movement

  • Functional coupling analysis:

    • Measure activities of individual domains versus full-length protein

    • Determine kinetic parameters to assess cooperative effects

    • Perform isothermal titration calorimetry to measure substrate binding

  • In vivo complementation studies:

    • Express variants in carotenoid-pathway deficient mutants

    • Analyze restoration of carotenoid production using HPLC

This systematic approach can reveal the structural basis for the observed functional interdependence of domains in bifunctional carotenoid enzymes .

How might changes in membrane composition affect the dual functionality of MGYG_02096?

As a membrane-associated protein with multiple transmembrane regions, MGYG_02096 activity is likely influenced by membrane composition. Advanced research should consider:

  • Lipid dependency studies:

    • Reconstitution in liposomes of varying lipid composition

    • Evaluation of both enzymatic activities in different membrane environments

    • Assessment of protein orientation in membranes using protease protection assays

  • Membrane fluidity effects:

    • Temperature-dependent activity measurements

    • Cholesterol/ergosterol content variation

    • Fatty acid composition alterations

  • Localization studies:

    • Fluorescent protein tagging for in vivo localization

    • Subcellular fractionation and activity distribution

    • Co-localization with other carotenoid biosynthetic enzymes

These investigations will provide insights into how the native membrane environment optimizes the dual functionality of this bifunctional enzyme and may suggest strategies for enhancing activity in heterologous systems .

What approaches can address the challenges in expressing full-length MGYG_02096?

Expressing membrane-associated proteins like MGYG_02096 presents several challenges that advanced researchers must address:

  • Hydrophobicity analysis and optimization:

    • Identify and potentially modify highly hydrophobic regions

    • Use fusion partners that enhance solubility (e.g., MBP, SUMO, thioredoxin)

    • Consider cell-free expression systems for toxic proteins

  • Translation optimization:

    • Identify rare codons and optimize codon usage

    • Modify translation initiation sites to enhance efficiency

    • Use specialized E. coli strains with expanded tRNA repertoires (e.g., Rosetta)

  • Preventing truncated products:

    • Design constructs with fusion tags at both N- and C-termini

    • Use gradient elution with increasing imidazole concentration to distinguish full-length protein

    • Employ Western blot analysis with antibodies against both N- and C-terminal tags

  • Expression condition screening:

    • Systematically vary temperature, inducer concentration, and duration

    • Test different media compositions

    • Evaluate co-expression with chaperones to enhance folding

These approaches should be implemented in a systematic manner with appropriate controls to identify optimal conditions for producing active, full-length protein .

What are the frontier research questions concerning bifunctional carotenoid enzymes like MGYG_02096?

Current unanswered questions that represent the frontiers of research on bifunctional carotenoid enzymes include:

  • Evolutionary significance:

    • Why have fungi evolved bifunctional enzymes while other organisms maintain separate proteins?

    • What selective advantages does this arrangement confer?

    • How did gene fusion events occur during evolution?

  • Structural dynamics:

    • How do the domains communicate at the molecular level?

    • What conformational changes occur during catalytic cycles?

    • How is substrate channeling accomplished between domains?

  • Regulatory mechanisms:

    • How is the expression fine-tuned in response to environmental conditions?

    • What post-translational modifications regulate activity?

    • How do membrane environments modulate function in vivo?

  • Biotechnological applications:

    • Can directed evolution enhance specific activities?

    • What modifications could improve stability for industrial applications?

    • How might protein engineering create novel carotenoid products?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular evolution, and synthetic biology techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.