Recombinant Arthroderma gypseum Probable endonuclease LCL3 (LCL3)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LCL3; MGYG_06031; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum)
Target Names
LCL3
Target Protein Sequence
MRWLFWASDNDKDGCKCNSKSSSSSDEKPTAPLKSNKDWNSLSNAINWSHYAEPSNLIPT
VLLTSGILFAFRIHRRYLRRIPEATNISPSYLRQRSILGKVTSVGDGDNFRIYHTPGGML
AGWGWLRKVPTSKKELKNNTIHIRIAGVDAPELAHFGRPSQPFGEEAHKWLINRLTGRRI
RAYVYRPDQYSRIVATVYAYRFLFFPQDIGLQMLREGLATVYEAKSGAEFGGPEQEKKYR
DAEALAKKKGKGLWKTKGSNDWESPRDFKSRMNAIDQGKDSST
Uniprot No.
Target Background
Database Links
STRING: 535722.XP_003171485.1
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
