Recombinant Arthroderma otae Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

AIM31 (UniProt accession: C5FSQ7) is a full-length mitochondrial protein (187 amino acids) encoded by Arthroderma otae, a dermatophyte species associated with fungal infections. The recombinant form is expressed in Escherichia coli with an N-terminal histidine (His) tag for purification and structural studies .

ParameterDetails
Protein Length187 amino acids
Host OrganismE. coli
TagN-terminal His-tag
Gene AccessionC5FSQ7
Expression SystemBacterial expression (recombinant)

Production Methodology

The recombinant AIM31 protein is synthesized through bacterial expression systems, leveraging E. coli for scalability and cost efficiency. Key steps include:

  • Cloning: Insertion of the AIM31 gene into an expression vector.

  • Fermentation: Growth of E. coli under optimized conditions to maximize yield.

  • Purification: Affinity chromatography using the His-tag .

This approach ensures high purity (>85% as determined by SDS-PAGE) and structural integrity for downstream applications .

Research Gaps and Future Directions

Current literature lacks functional studies on AIM31, necessitating further investigation:

  • Structural Characterization: X-ray crystallography or NMR to elucidate binding sites.

  • Interaction Mapping: Cross-linking mass spectrometry (CLMS) to identify mitochondrial partners, akin to SS-31 studies .

  • Pathogenicity Role: Transcriptomic analysis during host infection to correlate AIM31 expression with virulence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
RCF1; AIM31; MCYG_05729; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) (Microsporum canis)
Target Names
RCF1
Target Protein Sequence
MGDKPLPSSFDDNPDFFQDNPWKKLGRRLKEEPLVPLGIGATCYALFRAYRSMKMGDSVQ VNRMFRARIYAQAFTLLAVCAGSVYYKTERDQRKQLEKAMDLKKQQTKRDAWLKELEIRD QEDKDWQSRHAAIEQAAKGAELKPLGTDPAPETAERDQAEEPAAKEPGEGSGGGVLSAVK NLTWGSK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Arthroderma otae and how does it relate to Microsporum canis?

Arthroderma otae is the sexually reproducing (teleomorphic) species underlying the Microsporum canis complex. While M. canis is an anamorphic fungus, it presents sexual compatibility with strains of the Arthroderma otae complex in laboratory settings. Molecular studies have revealed significant genetic relationships between these organisms, with M. canis representing one of the main clades within the A. otae complex. Population structure analysis using various genetic markers has confirmed these relationships, demonstrating that while they may appear morphologically distinct, they share substantial genetic material .

What is the function of AIM31 protein in mitochondrial biology?

The Altered Inheritance of Mitochondria protein 31 (AIM31) in Arthroderma otae plays a crucial role in maintaining mitochondrial integrity and function. As a mitochondrial protein, AIM31 is involved in several key processes:

  • Regulation of mitochondrial inheritance during cell division

  • Maintenance of mitochondrial membrane integrity

  • Facilitation of protein import into the mitochondria

  • Participation in respiratory chain complex assembly

These functions are critical for cellular energy production and fungal viability, particularly in dermatophytes like A. otae that must adapt to challenging host environments .

How does the genetic structure of Arthroderma otae influence its protein expression?

The genetic structure of Arthroderma otae exhibits remarkable complexity, with significant molecular distance between + and - mating types. This genetic diversity influences protein expression patterns, including mitochondrial proteins like AIM31. Population structure analyses have revealed that A. otae consists of distinct subgroups with varying genetic markers. These genetic variations likely affect transcriptional regulation and post-translational modifications of proteins. The intermating community of A. otae/M. canis represents an ancestral condition from which clonal lineages have emerged, potentially leading to differential protein expression profiles between strains .

What are the optimal methods for isolating and purifying recombinant AIM31 from expression systems?

For optimal isolation and purification of recombinant Arthroderma otae AIM31, the following methodological approach is recommended:

Expression System Selection:

  • E. coli-based expression systems (such as BL21(DE3)) are most commonly used for mitochondrial proteins like AIM31

  • Yeast expression systems (S. cerevisiae or P. pastoris) may provide better folding for complex mitochondrial proteins

Purification Protocol:

  • Cell lysis using sonication or mechanical disruption in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Clarification by centrifugation at 20,000×g for 30 minutes at 4°C

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged AIM31

  • Size exclusion chromatography for final purification

  • Storage at -80°C with 50% glycerol as a cryoprotectant

Protein purity should be assessed using SDS-PAGE (target >85% purity) and Western blotting with anti-His antibodies or specific anti-AIM31 antibodies if available .

How can researchers effectively design primers for cloning and validating AIM31 expression?

Effective primer design for AIM31 cloning requires careful consideration of several factors:

Primer Design Strategy:

  • Analyze the AIM31 gene sequence from Arthroderma otae genomic databases

  • Identify conserved regions by aligning with homologous sequences from related species

  • Design primers with the following specifications:

    • Length: 18-30 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 55-65°C with <5°C difference between primer pairs

    • Avoid secondary structures and primer-dimer formation

Validation Primers:

  • For qRT-PCR validation, design primers spanning exon-exon junctions

  • Include restriction enzyme sites compatible with expression vector

  • Consider adding tag sequences (His, GST, etc.) for purification purposes

Optimization Table for PCR Amplification of AIM31:

ParameterInitial ConditionsOptimization RangeNotes
Annealing Temp58°C55-65°CGradient PCR recommended
MgCl₂ Concentration1.5 mM1.0-3.0 mMAffects polymerase activity
Template Amount50 ng10-100 ngGenomic DNA or cDNA
Extension Time1 min/kb30 sec-2 min/kbDepends on polymerase
Cycle Number3025-35Minimize non-specific products

Post-amplification validation should include sequencing to confirm correct amplification before proceeding to cloning steps .

What functional assays are most appropriate for characterizing AIM31 activity in vitro?

To characterize recombinant AIM31 activity in vitro, the following functional assays are recommended:

1. Mitochondrial Membrane Association Assays:

  • Liposome binding assays using fluorescently labeled recombinant AIM31

  • Sucrose gradient centrifugation with isolated mitochondrial membranes

2. Protein-Protein Interaction Studies:

  • Co-immunoprecipitation with known mitochondrial import machinery components

  • Yeast two-hybrid screening to identify interaction partners

  • Surface plasmon resonance (SPR) to determine binding kinetics

3. Functional Complementation:

  • Expression of AIM31 in aim31Δ yeast mutants to assess restoration of mitochondrial function

  • Measurement of respiratory capacity through oxygen consumption rates

4. Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure

  • Thermal shift assays to determine protein stability under various conditions

  • Limited proteolysis to identify stable domains

These assays should be complemented with appropriate controls, including known mitochondrial proteins with similar functions and negative controls lacking critical domains .

How does AIM31 variation across Arthroderma otae strains correlate with mitochondrial inheritance patterns?

AIM31 variation across different Arthroderma otae strains shows significant correlation with mitochondrial inheritance patterns. Population structure studies have revealed distinct genetic subgroups within the A. otae complex that influence mitochondrial biology:

  • The remarkable molecular distance between + and - mating types of A. otae suggests differential regulation of mitochondrial inheritance between these strains

  • Microsatellite marker analysis has identified distinct genotypes within the species complex that may affect AIM31 function

  • Clonal lineages that have emerged within a single biological species show varying mitochondrial inheritance patterns

Research indicates that sympatric speciation may occur even while mating ability is maintained, leading to distinct mitochondrial inheritance patterns across strains. The reduced frequency of mating events in natural populations suggests that mitochondrial inheritance regulation through proteins like AIM31 may have evolved differently in various lineages. This is particularly notable as cats have become the main reservoir for these fungi, potentially eliminating the soil-borne phase where mating partners would typically meet .

What methodologies are recommended for analyzing AIM31 sequence conservation across fungal species?

For analyzing AIM31 sequence conservation across fungal species, researchers should implement a multi-faceted bioinformatic approach:

Sequence Acquisition and Alignment:

  • Retrieve AIM31 homolog sequences from genomic databases (NCBI, FungiDB, JGI MycoCosm)

  • Perform multiple sequence alignment using tools like MUSCLE or CLUSTAL Omega

  • Refine alignments manually to ensure proper gap placement

Conservation Analysis Methods:

  • Calculate sequence identity and similarity matrices

  • Identify conserved domains using InterProScan or Pfam

  • Generate conservation plots using ConSurf or WebLogo

  • Conduct selective pressure analysis using dN/dS ratios

Phylogenetic Analysis:

  • Select appropriate evolutionary models using ModelTest

  • Construct phylogenetic trees using Maximum Likelihood and Bayesian methods

  • Evaluate node support with bootstrap analysis (>1000 replicates)

  • Compare gene trees with species trees to identify potential horizontal gene transfer events

Structure-Function Correlation:

  • Map conserved residues onto predicted 3D structures

  • Identify functionally important sites through conservation patterns

  • Correlate sequence variation with known functional differences

This comprehensive approach provides insights into evolutionary pressures on AIM31 and how its function may vary across dermatophyte species and related fungi .

How can recombinant AIM31 be used to study mitochondrial dysfunction in dermatophyte pathogenesis?

Recombinant AIM31 provides a powerful tool for investigating mitochondrial dysfunction in dermatophyte pathogenesis through several experimental approaches:

In vitro Models:

  • Develop cell-based assays using human keratinocytes or animal skin explants

  • Introduce fluorescently labeled recombinant AIM31 to track mitochondrial dynamics

  • Assess mitochondrial membrane potential changes using potentiometric dyes

  • Measure ATP production and respiratory capacity changes

Ex vivo Infection Models:

  • Establish reconstructed human epidermis (RHE) models infected with wild-type and AIM31-mutant A. otae strains

  • Analyze differences in fungal viability, penetration, and tissue damage

  • Measure host cell mitochondrial function during infection

Mechanistic Studies:

  • Use recombinant AIM31 as a competitive inhibitor to block native AIM31 function

  • Employ site-directed mutagenesis to create functional variants for comparative studies

  • Develop antibodies against recombinant AIM31 for immunolocalization studies

Differential Expression Analysis:

  • Compare AIM31 expression levels between virulent and attenuated strains

  • Correlate expression with mitochondrial function and pathogenicity

  • Investigate regulatory mechanisms controlling AIM31 expression

These approaches help elucidate how mitochondrial proteins like AIM31 contribute to the remarkable ability of dermatophytes like M. canis to evade immune responses and persist in keratinized tissues .

What are the challenges and solutions for expressing correctly folded AIM31 in prokaryotic systems?

Expression of correctly folded mitochondrial proteins like AIM31 in prokaryotic systems presents several challenges and requires specific solutions:

Key Challenges:

ChallengeImpactSolution Strategies
Codon usage biasReduced expression efficiencyCodon optimization or use of rare codon-supplemented E. coli strains
Disulfide bond formationMisfolding in reducing cytoplasmExpression with thioredoxin/glutaredoxin fusions or in SHuffle® E. coli strains
Post-translational modificationsAbsent in prokaryotic systemsExpression of core functional domains only or switch to eukaryotic systems
Inclusion body formationInsoluble protein aggregatesLower induction temperature (16-20°C), reduce IPTG concentration, use solubility tags
Proteolytic degradationReduced yieldProtease-deficient strains, addition of protease inhibitors

Methodological Solutions:

  • Expression Optimization:

    • Test multiple constructs with varying domain boundaries

    • Screen different fusion partners (MBP, GST, SUMO, Trx)

    • Optimize expression conditions (temperature, inducer concentration, duration)

  • Refolding Strategies:

    • Solubilize inclusion bodies using 8M urea or 6M guanidine HCl

    • Perform stepwise dialysis with decreasing denaturant concentration

    • Add folding enhancers (L-arginine, glycerol, low concentrations of detergents)

  • Co-expression Systems:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Include disulfide isomerases for disulfide bond formation

  • Quality Assessment:

    • Verify folding using circular dichroism spectroscopy

    • Assess function through activity assays

    • Compare to native protein isolated from fungal sources

These strategies should be systematically evaluated to achieve optimal expression of functionally active recombinant AIM31 .

How should researchers analyze mitochondrial protein interactions involving AIM31?

Analysis of mitochondrial protein interactions involving AIM31 requires a systematic approach combining multiple techniques:

Interaction Identification Methods:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Use tagged recombinant AIM31 as bait

    • Perform pulldowns from mitochondrial extracts

    • Identify interacting partners through LC-MS/MS

  • Proximity-based Labeling:

    • Generate BioID or APEX2 fusions with AIM31

    • Express in fungal cells or heterologous systems

    • Identify proximal proteins through biotinylation and streptavidin pulldown

  • In vitro Validation Techniques:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Microscale thermophoresis (MST) for affinity determination

    • ELISA-based binding assays for high-throughput screening

Data Analysis Framework:

  • Filter interaction data using appropriate controls

  • Apply statistical thresholds (p < 0.05, fold change > 2)

  • Cluster interactions by cellular compartment and function

  • Validate key interactions through reciprocal pulldowns

  • Construct interaction networks using Cytoscape or similar tools

Functional Validation:

  • Perform co-localization studies using fluorescently tagged proteins

  • Assess functional consequences of disrupting key interactions

  • Map interaction domains through truncation and mutation studies

This multi-layered approach provides robust data on AIM31's interaction partners and their functional significance in mitochondrial biology and dermatophyte pathogenesis .

What statistical approaches are most appropriate for analyzing AIM31 sequence variations in population studies?

For analyzing AIM31 sequence variations in population studies of Arthroderma otae and related species, researchers should employ these statistical approaches:

Population Genetics Metrics:

  • Nucleotide Diversity (π):

    • Measure average number of nucleotide differences per site

    • Calculate separately for coding and non-coding regions

    • Compare between functional domains

  • Fixation Indices (FST):

    • Quantify population differentiation

    • Identify potential local adaptations in AIM31

    • Calculate for different geographic isolates

  • Tajima's D and Fu & Li's F Tests:

    • Detect selection signatures

    • Distinguish between purifying and positive selection

    • Identify regions under selective pressure

Phylogenetic Methods:

  • Haplotype Network Analysis:

    • Construct median-joining networks

    • Visualize relationships between sequence variants

    • Identify ancestral and derived haplotypes

  • Bayesian Coalescent Analysis:

    • Estimate divergence times

    • Reconstruct demographic history

    • Implement in BEAST or similar software

Statistical Testing Framework:

Analysis TypeRecommended TestApplication
Between-group comparisonsAMOVAHierarchical population structure
Correlation with phenotypeLogistic regressionAssociation with virulence traits
Recombination detectionFour-gamete testIdentifying recombination hotspots
Demographic inferenceMismatch distributionPopulation expansion/bottlenecks
Selection detectionMcDonald-Kreitman testAdaptive evolution analysis

Computational Implementation:

  • Use appropriate software packages (Arlequin, DnaSP, MEGA, PAML)

  • Implement robust sampling strategies to avoid bias

  • Account for linkage disequilibrium when appropriate

  • Apply multiple testing corrections (FDR, Bonferroni)

These approaches, similar to those used in the population structure analysis of A. otae, provide statistical rigor for interpreting AIM31 sequence data in ecological and evolutionary contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.