Recombinant Arthroderma otae Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIC60; MCYG_02615; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-671
Protein Length
Full Length of Mature Protein
Species
Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) (Microsporum canis)
Target Names
MIC60
Target Protein Sequence
SKARSAGWPYESSIRPGTAVLPTRKTSCATFTSSATLRENEPNVRSPPSPSSASAITPEG VSKPPPSSPAAQGLTSPGSSVNPPEPPKTQTGAPPPPPPPPPARKAKGKFTRFLLYLVLT TGVAYAGGVWFSLKSDNFHDFFTEYVPYGEEAVLYLEELDFRRRFPNATRHINTRPAAPR DEGEKVTIPSKSGVSWKVAEKEGGSDVSQKGRHMSALDAETSRTTDKSKSAPKRPASEDK VVSETTGTKKDKSNERVPVTDTKKPAVSLDEPRKPAVPTVSSIEPLAALQDDATIQELTK IVNGLITVINADESASKLAAPLTKAKEDFLKLGEQISRIKEEALAAAKEEINNAHLEFDR SATELVRRIDEVRAEEAAQYREEFEMEREKLAHSYQEKIKTEIERANAVAEQRLRNELVE QAIEMNRKFLNDVETLVEKERGGRLSKLSELTAQVAELEKLTAGWNEVIGANLTTQQLQV AVDAVHTALESDSMPRPFINELLAVKGLAGQDPIVNAAISSINPTAYQRGIPSTSQIIDR FRRVANEVRKASLLPEDAGVASHATSYLMSKVMFKKEVSSSGDDVESILTRTEKLLEEGN LDEAAREMNALRGWSKLLSKDWLADQWMLTQAL
Uniprot No.

Target Background

Function

Recombinant Arthroderma otae Formation of Crista Junctions protein 1 (FCJ1) is a component of the Mitochondrial Contact Site and Cristae Organizing System (MICOS) complex. This large protein complex, located in the mitochondrial inner membrane, plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating the formation of contact sites with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane. Furthermore, it promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Arthroderma otae and what significance does it have in research?

Arthroderma otae is a fungal species that serves as a teleomorph (sexual form) of dermatophytes in the Microsporum genus. It has significant research importance as it encompasses both zoophilic species (M. canis) and anthropophilic species (M. audouinii and M. ferrugineum), making it essential for understanding infection origins and transmission risks in dermatology . The identification of specific species within this complex is particularly valuable for epidemiological studies and determining appropriate treatment strategies. As a model organism, recombinant proteins from A. otae, such as ribosomal proteins, are utilized in various experimental applications including Western blotting and ELISA .

What is the relationship between FCJ1 and the MICOS complex?

FCJ1 (Formation of Crista Junction protein 1) is a nomenclature predominantly used in yeast research and corresponds to the Mic60 subunit of the MICOS complex in humans. As evidenced in research on cristae formation, the Mic60-subcomplex (which is homologous to FCJ1 in yeast) is sufficient for crista junction formation, while the Mic10-subcomplex controls lamellar cristae biogenesis . This functional differentiation demonstrates how the MICOS complex components have evolved specialized roles in maintaining mitochondrial inner membrane architecture. The assembly of the complete MICOS complex triggers remodeling of pre-existing unstructured cristae and de novo formation of crista junctions on existing cristae .

What are the most effective methods for identifying species within the Arthroderma otae complex?

Current research indicates that PCR-based approaches provide highly effective methods for identifying species within the Arthroderma otae complex. Specifically, two PCR assays designed based on differences in DNA fragments encoding β-tubulin have demonstrated 100% sensitivity and specificity in identifying M. canis and distinguishing it from M. audouinii/M. ferrugineum using both traditional and real-time PCR techniques . This methodological approach is superior to conventional morphological identification, which can be time-consuming and requires specialized expertise. The developed assays can be conducted using DNA isolated by rapid methods from culture, making them suitable for routine laboratory use and epidemiological studies .

How can researchers effectively isolate and characterize recombinant proteins from Arthroderma otae?

The isolation and characterization of recombinant proteins from Arthroderma otae require specific protocols optimized for fungal expression systems. Based on established methodologies for recombinant A. otae proteins, researchers should consider:

  • Expression System Selection: Heterologous expression in E. coli or yeast systems with appropriate codon optimization

  • Purification Protocol: Using affinity chromatography (typically His-tag based) followed by size-exclusion chromatography

  • Characterization Methods: SDS-PAGE for purity assessment (aiming for >85% purity) and mass spectrometry for sequence verification

  • Storage Considerations: Maintaining protein stability in Tris-based buffer with 50% glycerol at -20°C to -80°C, with an expected shelf life of approximately 6 months

The application of these recombinant proteins in Western blotting and ELISA requires validation of their functional activity and specificity before use in complex experimental setups.

What techniques are most valuable for studying the formation and dynamics of crista junctions?

The most valuable techniques for studying crista junction formation and dynamics combine high-resolution imaging with genetic manipulation approaches. Recent research has employed:

  • Super-resolution light microscopy (STED nanoscopy) to visualize the distribution and organization of MICOS components like Mic60

  • 3D electron microscopy to analyze detailed ultrastructural changes in cristae morphology

  • CRISPR/Cas9 genome editing to generate knockout cell lines for individual MICOS subunits, enabling systematic analysis of their specific roles

  • Inducible expression systems to study the temporal dynamics of cristae remodeling upon re-expression of specific proteins

  • RNAi-mediated depletion for comparative analysis of partial vs. complete loss of function

These complementary approaches provide multilevel insights into both structural and functional aspects of crista junction biology.

How do the Mic10 and Mic60 subcomplexes coordinate to regulate cristae morphology?

The coordination between Mic10 and Mic60 subcomplexes in regulating cristae morphology involves distinct but complementary functions. Research using knockout cell lines has revealed that the Mic60-subcomplex is specifically responsible for crista junction formation, providing the basic structural framework for these membrane connections . In contrast, the Mic10-subcomplex controls the development of lamellar cristae, influencing the expansion and organization of the inner membrane folds .

Further analysis has shown that when Mic10 is re-expressed in Mic10-knockout cells, it causes extensive remodeling of pre-existing aberrant cristae, including the formation of secondary crista junctions . The antagonistic relationship between these subcomplexes is particularly evident in the context of Mic60 assembly patterns:

ConditionMic60 Assembly PatternCristae Morphology
Wild-typeRod-shaped clustersNormal lamellar cristae with regular CJs
Mic10-KOSmall scattered clustersAbnormal, predominantly tubular cristae
OPA1-depletedLarge ring- and rib-like assembliesShorter, disordered, partly swollen cristae
Mic10-KO + OPA1-depletedSmall scattered clustersSeverely disrupted cristae architecture

This complex interplay demonstrates that proper cristae morphology requires balanced activities of both subcomplexes rather than independent parallel pathways .

What is the functional significance of OPA1 in stabilizing tubular crista junctions?

OPA1 plays a multifaceted role in crista junction biology, with research demonstrating its significance in maintaining junction stability and influencing MICOS distribution. Depletion of OPA1 in wild-type cells produces a moderate cristae phenotype characterized by shorter, disordered, or partly swollen cristae, indicating its role in maintaining normal cristae architecture . More specifically, OPA1 stabilizes tubular crista junctions, which is essential for maintaining the proper connectivity between cristae and the inner boundary membrane .

Additionally, OPA1 influences the formation and distribution of MICOS assemblies. In OPA1-deficient mitochondria, Mic60 forms conspicuously larger ring- and rib-like assemblies compared to the rod-shaped Mic60 clusters observed in wild-type cells . This regulatory effect appears to be mediated through interaction with the Mic10 subcomplex, as evidenced by the observation that in Mic10-knockout cells devoid of OPA1, Mic60 localizes in small scattered clusters rather than extended assemblies .

The stabilization of tubular junctions by OPA1 likely contributes to cristae remodeling during apoptosis and mitochondrial dynamics, representing a critical interface between mitochondrial structure and cellular life-death decisions.

How can researchers distinguish between direct and indirect effects when manipulating MICOS complex components?

Distinguishing between direct and indirect effects when manipulating MICOS complex components requires sophisticated experimental design and controls. Researchers should consider implementing:

  • Temporal Analysis: Using inducible expression systems to monitor immediate vs. delayed effects following protein re-expression. For example, research has shown that re-expression of Mic10 in knockout cells allows tracking of cristae remodeling over time, distinguishing primary structural changes from secondary adaptations .

  • Combinatorial Knockouts and Rescue Experiments: Systematically disrupting multiple components to identify epistatic relationships. The observation that Mic10 expression in OPA1-depleted cells leads to redistributed Mic60 patterns and partial cristae recovery helps distinguish direct effects of Mic10 from those dependent on OPA1 .

  • Domain-Specific Mutations: Introducing specific mutations that affect particular protein-protein interactions rather than eliminating entire proteins. This approach can help isolate the contribution of individual interaction sites to complex assembly and function.

  • Quantitative Proteomics: Analyzing changes in the mitochondrial proteome following MICOS manipulation to identify compensatory responses that might confound interpretation of phenotypes.

  • In vitro Reconstitution: Reconstituting minimal systems with purified components to verify direct biochemical activities independent of cellular context.

What are the current challenges in developing recombinant protein models for studying crista junction dynamics?

Developing recombinant protein models for studying crista junction dynamics faces several significant challenges:

  • Structural Complexity: Crista junction proteins function within large multiprotein complexes (MICOS) whose assembly and regulation are incompletely understood. Recombinant expression often produces individual components that may lack proper folding or interaction partners .

  • Membrane Association: Many MICOS components are membrane proteins with complex topologies that are difficult to express and purify in functional form. The Mic60 subcomplex in particular has membrane-shaping properties that are challenging to recreate in vitro .

  • Species-Specific Differences: While homologs exist across species (e.g., FCJ1 in yeast corresponding to Mic60 in humans), their functional conservation may be incomplete, complicating cross-species interpretation .

  • Context Dependency: Crista junction formation depends on interactions with other mitochondrial components including OPA1 and F1Fo-ATP synthase, making isolated protein studies potentially artifactual .

  • Dynamic Regulation: The system undergoes continuous remodeling in response to cellular signals, which is difficult to capture in static recombinant protein systems.

Researchers are addressing these challenges through development of partial reconstitution systems, membrane mimetics, and advanced imaging techniques that can capture dynamic interactions in near-native environments.

How might the study of Arthroderma otae MICOS homologs contribute to our understanding of mitochondrial evolution?

The study of MICOS homologs in Arthroderma otae could provide valuable insights into mitochondrial evolution, particularly regarding the conservation and divergence of cristae organization mechanisms across fungal lineages. Comparative analysis of MICOS components between the anthropophilic and zoophilic species within the A. otae complex might reveal adaptations in mitochondrial architecture related to host specialization and pathogenicity .

While the search results don't specifically address A. otae MICOS homologs, research on mitochondrial proteins in this organism could contribute to evolutionary understanding by:

  • Identifying lineage-specific innovations in cristae architecture that correlate with metabolic requirements

  • Revealing potential horizontal gene transfer events involving mitochondrial structural proteins

  • Providing insight into the co-evolution of nuclear-encoded mitochondrial proteins with mitochondrial genomes

  • Establishing phylogenetic relationships based on conservation of mitochondrial structural components

Such comparative studies would complement the extensive work already done on model organisms like yeast and human cells, potentially uncovering novel regulatory mechanisms.

What methodological innovations might improve the study of dynamic changes in crista junction morphology?

Several methodological innovations show promise for advancing the study of dynamic changes in crista junction morphology:

  • Live-Cell Super-Resolution Microscopy: Extending current STED nanoscopy approaches to live-cell imaging would allow real-time visualization of crista junction dynamics in response to metabolic and apoptotic signals.

  • Correlative Light and Electron Microscopy (CLEM): Combining the molecular specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy would enable tracking of specific proteins during crista remodeling events.

  • Expanded Genome Editing Approaches: Building on CRISPR/Cas9 systems to create conditional knockouts, point mutations, and tagged endogenous proteins for more nuanced manipulation of MICOS components.

  • Advanced Cryo-Electron Tomography: Implementing direct electron detectors and phase plates to improve resolution of tomographic reconstructions of crista junctions in their native state.

  • Tension-Sensing Fluorescent Probes: Developing probes that respond to membrane curvature or mechanical forces at crista junctions to measure biophysical properties during remodeling.

These technological advances would address current limitations in temporal resolution and the ability to connect molecular events with structural changes.

How does the interplay between MICOS, OPA1, and F1Fo-ATP synthase influence mitochondrial function in disease states?

The interplay between MICOS, OPA1, and F1Fo-ATP synthase has profound implications for mitochondrial function in disease states, as these protein complexes collectively determine cristae architecture and consequently influence respiratory efficiency and apoptotic signaling. Research indicates that genetic and physical interactions exist between these three major cristae organizers .

In disease contexts, this tripartite relationship may be disrupted in several ways:

  • Neurodegenerative Diseases: Mutations in OPA1 cause dominant optic atrophy, while MICOS dysfunction has been implicated in various neurodegenerative conditions. The resulting abnormal cristae architecture likely compromises ATP production and increases susceptibility to apoptosis .

  • Cancer: Altered cristae morphology in cancer cells often correlates with metabolic reprogramming. The interaction between MICOS and F1Fo-ATP synthase may influence the efficiency of oxidative phosphorylation versus glycolysis in tumor cells.

  • Cardiovascular Diseases: Proper cristae organization is essential for cardiomyocyte function. Disruption of the OPA1-MICOS axis can lead to mitochondrial fragmentation and myocardial dysfunction.

  • Aging: Age-related decline in mitochondrial function correlates with alterations in cristae architecture. The maintenance of proper interactions between MICOS, OPA1, and F1Fo-ATP synthase may be critical for longevity.

Research shows that OPA1, along with F1Fo-ATP synthase, fine-tunes the positioning of the MICOS complex and crista junctions, suggesting a coordinated system where perturbation of any component has ripple effects throughout mitochondrial structure and function .

What statistical approaches are most appropriate for analyzing changes in crista junction number and morphology?

When analyzing changes in crista junction number and morphology, researchers should employ statistical approaches that account for the complex, three-dimensional nature of these structures and biological variability. Based on current research methodologies , appropriate statistical approaches include:

  • Quantitative Morphometric Analysis: Measuring parameters such as:

    • Crista junction diameter and length

    • Number of junctions per mitochondrion or per unit of mitochondrial surface area

    • Cristae lamellarity index (ratio of lamellar to tubular cristae)

  • Distribution Analysis: Rather than simple means, analyzing the complete distribution of morphological features using:

    • Kernel density estimation

    • Q-Q plots to compare distributions between experimental groups

    • Classification of morphotypes followed by contingency table analysis

  • Spatial Statistics: Considering the non-random distribution of crista junctions:

    • Nearest-neighbor analysis to quantify clustering patterns

    • Ripley's K-function to characterize spatial organization at different scales

  • Mixed-Effects Models: Accounting for hierarchical data structure (multiple cristae within mitochondria within cells) when testing for treatment effects.

  • Machine Learning Approaches: Training algorithms to recognize and classify crista junction morphologies from electron microscopy data for high-throughput analysis.

To properly implement these approaches, researchers should ensure appropriate sampling (typically analyzing hundreds of mitochondrial sections across multiple biological replicates) and blinded analysis to prevent observation bias .

How can researchers differentiate between primary defects in crista junction formation and secondary consequences of mitochondrial dysfunction?

Differentiating between primary defects in crista junction formation and secondary consequences of mitochondrial dysfunction requires careful experimental design and interpretation. Based on research strategies employed in MICOS studies , researchers should consider:

  • Temporal Analysis of Phenotypes: Monitoring the sequence of events following genetic manipulation:

    • Early structural changes (within hours) likely represent primary effects

    • Later alterations (days) may reflect adaptive or compensatory responses

  • Correlation with Functional Parameters: Measuring mitochondrial function simultaneously with structural analysis:

    • Respiratory capacity

    • Membrane potential

    • ROS production

    • mtDNA maintenance

  • Rescue Experiments with Targeted Specificity:

    • Expression of minimal functional domains rather than complete proteins

    • Use of heterologous proteins with conserved function but divergent sequence

  • Comparative Analysis Across Multiple Manipulation Strategies:

    • Direct comparison between acute (RNAi) and chronic (knockout) disruption

    • Pharmacological versus genetic perturbation

  • In vitro Reconstitution: Testing if purified components can directly induce membrane remodeling in synthetic liposomes lacking the complexity of intact mitochondria.

Research on OPA1 depletion versus MICOS subunit knockouts provides an illustrative example: OPA1 depletion causes a moderate cristae phenotype, while Mic60-KO cells show more severe structural defects, helping distinguish their primary roles in cristae maintenance .

What are the most informative control experiments when studying MICOS complex assembly and function?

When studying MICOS complex assembly and function, the most informative control experiments ensure proper interpretation of results and rule out artifactual findings. Based on established research approaches , essential controls include:

Control TypePurposeImplementation
Genetic ComplementationVerify phenotype specificityRe-expression of the disrupted gene in knockout cells should rescue the observed defects
Domain MutantsIdentify functional regionsExpression of proteins with specific domain mutations to pinpoint essential interaction sites
Related Protein ControlsTest for functional redundancyKnockdown/knockout of related proteins (e.g., different MICOS subunits) to identify compensatory mechanisms
Temporal ControlsDistinguish acute vs. chronic effectsInducible systems and time-course analyses to monitor adaptation processes
Cell Type ControlsAccount for tissue-specific differencesParallel experiments in multiple cell types with different metabolic profiles
Pharmacological ValidationConfirm mechanistic interpretationsUse of specific inhibitors of mitochondrial function (e.g., OXPHOS inhibitors) to distinguish primary from secondary effects
Double/Triple KnockoutsIdentify genetic interactionsSystematic disruption of multiple components to establish epistatic relationships (e.g., Mic10-KO with OPA1 depletion)

Additionally, researchers should implement subcellular fractionation controls to verify proper isolation of mitochondria and submitochondrial compartments when analyzing protein localization and complex assembly . These controls collectively strengthen mechanistic interpretations of MICOS function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.