Recombinant Arthroderma otae High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Osmosensing

SHO1 acts as a primary sensor in the HOG pathway, which regulates glycerol synthesis and efflux to counterbalance extracellular osmotic pressure. Key functions include:

  • Signal Transduction: Detects osmotic stress via its transmembrane domains and relays signals to the Hog1 MAPK through interactions with Pbs2 kinase .

  • Oxidative Stress Response: In C. albicans, Sho1 mutants exhibit hypersensitivity to hydrogen peroxide and menadione, suggesting a conserved role in oxidative stress adaptation .

Recombinant Production and Applications

Recombinant A. otae SHO1 is produced in heterologous systems for biochemical and functional studies:

  • Expression Systems:

    • Escherichia coli (full-length, His-tagged variants) .

    • Cell-free systems for transmembrane protein synthesis .

  • Storage: Lyophilized powder or liquid in Tris/PBS buffer with 6% trehalose (pH 8.0), stable at -80°C .

Table 2: Recombinant SHO1 Production Parameters

ParameterDetails
HostE. coli, cell-free systems
TagN-terminal His tag (for purification)
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol for long-term storage
ApplicationsEnzyme kinetics, structural studies, antifungal drug discovery

Research Findings

Recent studies highlight SHO1’s broader roles beyond osmosensing:

  • Cell Wall Integrity: In C. albicans, Sho1 mutants display altered cell wall architecture, increased aggregation, and sensitivity to Congo red .

  • Morphogenesis: Deletion of SHO1 impairs hyphal growth under stress conditions (e.g., Spider medium), linking it to virulence in pathogenic fungi .

  • Cross-Kingdom Conservation: Structural and functional parallels with S. cerevisiae Sho1 suggest evolutionary conservation in stress signaling .

Potential Research Applications

  • Antifungal Targets: SHO1’s role in stress adaptation makes it a candidate for drug development against dermatophytosis .

  • Signal Transduction Studies: Mechanistic insights into MAPK pathway regulation .

Outstanding Questions

  • How does A. otae SHO1 interact with other HOG pathway components (e.g., Ssk1)?

  • Does Sho1 contribute to virulence in A. otae infections, as observed in C. albicans?

For further investigations, recombinant SHO1’s availability in multiple expression systems (e.g., E. coli, baculovirus) enables diverse experimental approaches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SHO1; MCYG_01636; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) (Microsporum canis)
Target Names
SHO1
Target Protein Sequence
MARFQMSNLVGDPFALATVSIAILAWIITVVSCIIAQTKEAIPNFFWWSVAYQFCIVVGI TAVMGSNTGHVYSTAIVGYAAAGLVCTTFTIDGLVTSKEGARQSGGAGLILLAMTDIVWI FYFGSTPQSRPRTYIDSFAPHKEQPSYRSSKPISHSYTPRPETTVSSAHQPHLYSSAPLS GFESSPMAGYNATTASSTGIQPMVGLQTNASTVGGDTAEIGQPTEYPYRAKAIYSYEANP DDANEISFTKHEILEVSDVSGRWWQAKKSTGETGIAPSNYLILL
Uniprot No.

Target Background

Function

Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.

Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does SHO1 function as an osmosensor in dermatophytes?

SHO1 functions as part of the High Osmolarity Glycerol (HOG) pathway, serving as one of the upstream sensors that detect changes in external osmolarity. In Saccharomyces cerevisiae, which provides the model for understanding this pathway in fungi, SHO1 operates independently but in a functionally redundant manner with another sensor protein, Sln1 . When activated by osmotic stress, SHO1 triggers a signaling cascade that ultimately activates Hog1, a mitogen-activated protein kinase (MAPK) that controls osmoadaptive responses.

In dermatophytes, the SHO1 protein likely maintains this core osmosensing function but may have evolved additional roles specific to filamentous fungi. Research in Arthrobotrys oligospora demonstrates that components of the HOG pathway, including osmosensors like Msb2 (which works with SHO1), are involved not only in osmoregulation but also in other biological processes such as growth, development, and pathogenicity .

What is the relationship between SHO1 and other components of the HOG pathway?

SHO1 is part of a complex signaling network within the HOG pathway. In the upstream portion of this pathway, SHO1 works in conjunction with other osmosensors, particularly Msb2 and Hkr1, which are functionally redundant . These sensors detect osmotic stress and transmit signals downstream to activate the Hog1 MAPK.

The relationship between these components can be visualized as follows:

ComponentFunctionRelationship to SHO1
SHO1Tetraspanning membrane osmosensorCore component of one branch of HOG pathway
Msb2Membrane mucin osmosensorFunctions redundantly with SHO1 in some fungi
Hog1Mitogen-activated protein kinaseDownstream effector activated by SHO1 signaling
Sln1Transmembrane histidine kinaseOperates in parallel branch to SHO1

While the core architecture of this pathway is conserved across fungi, the specific roles and interactions may vary between species. In dermatophytes like Arthroderma species, the HOG pathway components likely contribute to both osmotic stress responses and pathogenicity mechanisms .

What expression systems are optimal for producing recombinant SHO1 protein?

Based on the available information, E. coli has been successfully used for the expression of recombinant SHO1 protein from Arthroderma benhamiae . When designing an expression system for SHO1, researchers should consider:

  • Expression vector selection: Vectors containing His-tag sequences have been effectively used for SHO1 expression, allowing for subsequent purification using affinity chromatography .

  • Host cell considerations: E. coli serves as an effective expression host for full-length SHO1 (1-285aa) from A. benhamiae, resulting in protein with greater than 90% purity as determined by SDS-PAGE .

  • Protein solubility: As a membrane protein, SHO1 may present solubility challenges. The successful expression reported in the search results suggests that the full-length protein, including transmembrane domains, can be expressed in E. coli while maintaining its structural integrity.

For dermatophyte proteins like those from Arthroderma species, it's important to optimize codon usage for the expression host and to carefully design constructs that maintain functional domains while enhancing expression efficiency.

What are the recommended storage and reconstitution protocols for maintaining SHO1 protein activity?

To maintain the activity and stability of recombinant SHO1 protein, the following protocols are recommended based on available data:

Storage conditions:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the recommended default)

  • Aliquot for long-term storage at -20°C/-80°C

The storage buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) appears to be optimized for maintaining protein stability . The addition of glycerol serves as a cryoprotectant to prevent protein denaturation during freeze-thaw cycles.

How can researchers create genetic models to study SHO1 function in dermatophytes?

Researchers can develop genetic models to study SHO1 function in dermatophytes using transformation approaches adapted for filamentous fungi. Based on the search results, the following methodology has been successful for dermatophyte transformation:

  • Protoplast preparation:

    • Grow the fungus in appropriate liquid medium

    • Harvest mycelia and treat with a combination of cell wall-degrading enzymes (Lysing Enzyme, Kitalase, and Yatalase) in osmotically stabilized buffer

    • Monitor cell wall digestion by light microscopy (approximately 2 hours)

    • Filter through Miracloth to remove debris

    • Collect protoplasts by centrifugation and resuspend in STC buffer (1.2 mol/l sorbitol, 10 mmol/l Tris-HCl, pH 7.5, 10 mmol/l CaCl2)

  • PEG-mediated transformation:

    • Mix protoplasts with plasmid DNA and spermidine

    • Add 60% PEG 4000 solution and incubate

    • Resuspend protoplasts in STC buffer

    • Plate on selective media containing an appropriate selection marker

  • Verification of transformation:

    • Extract genomic DNA from transformants

    • Perform Southern blot hybridization to confirm integration of the construct

For SHO1-specific studies, researchers could design knockout constructs, fluorescent protein fusions, or site-directed mutants to investigate the protein's function in osmosensing and pathogenicity.

How does SHO1 contribute to fungal adaptation to environmental stresses?

SHO1 plays a critical role in fungal adaptation to environmental stresses, particularly osmotic stress. As an upstream sensor in the HOG pathway, it detects changes in external osmolarity and initiates signaling cascades that lead to adaptive responses. The contribution of SHO1 to stress adaptation includes:

  • Osmotic stress sensing: SHO1 functions as a membrane sensor that detects changes in osmolarity and triggers appropriate cellular responses .

  • Signal transduction: Upon activation, SHO1 initiates a signaling cascade that ultimately activates the Hog1 MAPK, which controls various osmoadaptive responses .

  • Growth regulation: Studies in model fungi show that components of the SHO1-mediated pathway influence growth under stress conditions. For example, in A. oligospora, deletion of msb2 (which functions with SHO1) resulted in reduced growth even under normal conditions, indicating a role beyond simple osmosensing .

  • Development regulation: The HOG pathway components, including upstream sensors like SHO1, may regulate developmental processes such as conidiation. In A. oligospora, deletion of hog1 resulted in defects in conidial formation, suggesting that this pathway influences asexual reproduction in filamentous fungi .

What is the relationship between SHO1 function and fungal pathogenicity?

The relationship between SHO1 function and fungal pathogenicity appears to be significant, though the specific mechanisms may vary between fungal species:

  • Role in predation efficiency: In the nematode-trapping fungus A. oligospora, deletion of components in the HOG pathway (including msb2, which functions with SHO1) caused a reduction in trap formation and predation efficiency, demonstrating a role in pathogenicity .

  • Connection to virulence in pathogens: In various filamentous fungi, the HOG pathway is essential for virulence. While S. cerevisiae HOG1 mainly regulates osmoregulation, its orthologs in pathogenic fungi often have additional roles in pathogenicity .

  • Stress adaptation during infection: The ability to adapt to osmotic stress environments is particularly important for dermatophytes colonizing the host skin. SHO1-mediated osmoadaptation likely contributes to survival during infection.

  • Species-specific pathogenicity mechanisms: The specific contribution of SHO1 to pathogenicity may differ between dermatophyte species. The search results mention Arthroderma benhamiae as one of the "main source of two zoonotic species of the Trichophyton mentagrophytes complex in Switzerland" , suggesting its clinical relevance in dermatophytosis.

How does the function of SHO1 differ between model yeasts and filamentous fungi like Arthroderma?

The function of SHO1 shows both conservation and divergence between model yeasts like S. cerevisiae and filamentous fungi like Arthroderma:

What are the challenges in studying membrane proteins like SHO1 in dermatophytes?

Studying membrane proteins like SHO1 in dermatophytes presents several significant challenges:

How can researchers differentiate between SHO1 and SLN1 branch contributions to HOG pathway activation?

Differentiating between the contributions of the SHO1 and SLN1 branches to HOG pathway activation requires sophisticated experimental approaches:

  • Genetic dissection: Creating single and double mutants of components specific to each branch allows researchers to determine their relative contributions. For example:

    • SHO1 deletion mutants to eliminate the SHO1 branch

    • SLN1 pathway component mutants to eliminate the SLN1 branch

    • Double mutants to eliminate both branches

    The phenotypic analysis of these mutants under various stress conditions can reveal the relative importance of each branch .

  • Pathway-specific reporters: Developing reporters that specifically respond to activation of either the SHO1 or SLN1 branch would allow researchers to monitor pathway-specific activation in real-time.

  • Phosphorylation analysis: Since the HOG pathway involves protein phosphorylation cascades, analyzing the phosphorylation status of downstream components in various mutant backgrounds can help distinguish branch-specific contributions.

  • Transcriptional profiling: Each branch may activate partially overlapping but distinct sets of genes. RNA-seq or similar approaches comparing gene expression changes in branch-specific mutants can help delineate their unique contributions.

  • Species-specific considerations: The relative importance of each branch may vary between fungal species. In S. cerevisiae, the two branches are functionally redundant, but in filamentous fungi like Arthroderma, their roles and relative contributions may differ .

What novel approaches could advance our understanding of SHO1 function in dermatophyte pathogenesis?

Several innovative approaches could significantly advance our understanding of SHO1 function in dermatophyte pathogenesis:

  • CRISPR-Cas9 genome editing: Adapting CRISPR-Cas9 technology for dermatophytes would facilitate more precise genetic manipulation, allowing researchers to create targeted mutations, tagged proteins, or conditional alleles of SHO1 and related genes.

  • Single-cell analysis: Applying single-cell transcriptomics or proteomics to infected tissues could reveal how SHO1-mediated signaling varies across fungal populations during infection.

  • Host-pathogen interaction models: Developing improved in vitro or ex vivo models of dermatophyte infection would allow better characterization of SHO1's role during different stages of pathogenesis.

  • Structural biology approaches: Applying cryo-electron microscopy or other advanced structural techniques to SHO1 and its interaction partners could reveal the molecular mechanisms of osmosensing and signal transduction.

  • Comparative genomics and evolution: Analyzing SHO1 sequences and pathway components across multiple dermatophyte species could reveal how this system has evolved and adapted to different host environments.

  • Pharmacological inhibition: Developing specific inhibitors of SHO1 or its interaction partners could both validate their roles in pathogenesis and potentially lead to novel antifungal strategies.

  • Multi-omics integration: Combining genomics, transcriptomics, proteomics, and metabolomics data from both pathogen and host could provide a systems-level understanding of how SHO1-mediated signaling contributes to successful infection.

How can recombinant SHO1 be used to develop new antifungal strategies?

Recombinant SHO1 protein can be leveraged in several ways to develop novel antifungal strategies:

  • Drug target validation: Purified recombinant SHO1 can be used in binding and functional assays to validate it as a potential target for antifungal drugs. The availability of high-purity recombinant protein (>90% as determined by SDS-PAGE) facilitates such studies .

  • High-throughput screening: Recombinant SHO1 can be employed in screening assays to identify small molecules that disrupt its function, potentially leading to new classes of antifungals that target stress adaptation pathways.

  • Structure-based drug design: If the three-dimensional structure of SHO1 can be determined using the recombinant protein, this information could guide the rational design of inhibitors that specifically target this osmosensor.

  • Antibody development: Recombinant SHO1 could be used to generate antibodies that might have diagnostic or therapeutic applications in dermatophyte infections.

  • Vaccine development: Although challenging for fungal infections, recombinant SHO1 or epitopes derived from it might serve as vaccine candidates, particularly if SHO1 is exposed on the cell surface during infection.

  • Disrupting host-pathogen interactions: If SHO1 participates in interactions with host tissues or immune components, recombinant protein could be used to characterize and potentially block these interactions.

What are the most promising research directions for understanding SHO1 function in dermatophytes?

Based on the available information, several promising research directions emerge for advancing our understanding of SHO1 function in dermatophytes:

  • Comparative analysis across dermatophyte species: Given that Arthroderma benhamiae is mentioned as a zoonotic species related to the Trichophyton mentagrophytes complex , comparing SHO1 function across multiple dermatophyte species could reveal species-specific adaptations relevant to their particular host ranges and infection strategies.

  • Connection to clinical presentation: Investigating the relationship between SHO1 function and the clinical presentation of dermatophytosis could provide insights into virulence mechanisms. The search results mention "emerging atypical and unusual presentations of dermatophytosis" , which might be related to variations in stress response pathways.

  • Integration with other signaling networks: Exploring how the SHO1-mediated HOG pathway interacts with other signaling networks in dermatophytes would provide a more comprehensive understanding of stress adaptation and pathogenicity.

  • Host-pathogen interface: Examining how SHO1-mediated signaling responds to and influences the host environment, particularly in terms of pH, temperature, and immune factors present on the skin, would illuminate its role in successful colonization.

  • Evolutionary analysis: Investigating how SHO1 and the HOG pathway have evolved in dermatophytes compared to other fungi could reveal adaptations specific to the dermatophyte lifestyle and host range.

  • Translational applications: Developing SHO1 or HOG pathway-based diagnostic tools or treatments for dermatophytosis represents an important direction for applied research in this field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.