Recombinant Artibeus jamaicensis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Key Features:

CharacteristicDetails
Gene OriginMitochondrial genome of Artibeus jamaicensis (GenBank: O99602)
Protein Structure98 amino acids (11 kDa), hydrophobic transmembrane domain
FunctionCore subunit of Complex I; facilitates electron transfer from NADH to ubiquinone
Genetic OverlapPartial overlap with MT-ND4 gene in bat mitochondrial DNA

MT-ND4L is part of the minimal assembly required for NADH dehydrogenation and ubiquinone reduction. Its role in Complex I includes stabilizing the enzyme’s structure and enabling proton pumping across the inner mitochondrial membrane .

Recombinant Production:

  • Host System: Expressed in E. coli .

  • Purity: ≥85% via SDS-PAGE .

  • Tag: N-terminal His-tag for purification and detection .

  • Storage: Lyophilized form stable for 12 months at -20°C/-80°C; liquid form stable for 6 months .

Biochemical Data:

ParameterValue
EC Number1.6.5.3
Subcellular LocalizationMitochondrial inner membrane
Amino Acid SequenceMSLTYMNMFMAFTISLLGLLMYRSHMMSSLLCLEGMmLSLFVMMTITILNTHLTLASmLP IILLVFAACEAALGLSLLVMVSTTYGMDYVQNLNLLQC

Mitochondrial Disease Models

MT-ND4L is used to study Leber hereditary optic neuropathy (LHON) and mitochondrial complex I deficiency. Mutations in human MT-ND4L (e.g., T10663C) disrupt Complex I activity, leading to ATP depletion and optic nerve degeneration . Recombinant bat MT-ND4L aids in elucidating species-specific mechanisms of Complex I dysfunction .

Metabolic Disorders

  • Obesity and Diabetes: Variants in MT-ND4L correlate with increased BMI and metabolic dysregulation. Recombinant proteins enable functional studies linking mitochondrial gene expression to disease .

  • Cancer: Elevated MT-ND4L expression in colorectal tumors suggests a role in tumor energy metabolism. Recombinant proteins are used to analyze Complex I activity in cancerous vs. normal tissues .

Comparison with Other Complex I Subunits

SubunitGeneRole in Complex IDisease Association
ND4LMT-ND4LTransmembrane stabilization, proton pumpingLHON, metabolic disorders
ND1MT-ND1FMN binding, electron transferLHON, mitochondrial myopathies
ND4MT-ND4Quinone-binding site formationLHON, encephalopathies
ND5MT-ND5Proton translocation pathwaysNeurodegenerative diseases

Complex I Assembly

  • ND4L Dependency: Absence of ND4L prevents assembly of the 950-kDa Complex I holoenzyme and abolishes NADH dehydrogenase activity .

  • Hydrophobicity: Bat MT-ND4L’s lower hydrophobicity (vs. human orthologs) facilitates nuclear-encoded subunit import in Chlamydomonas .

ATP Production

  • Electron Transfer: MT-ND4L participates in transferring electrons from FMNH₂ to ubiquinone, generating a proton gradient .

  • Inhibitor Studies: Quinazolines disrupt ubiquinone binding near ND4L-containing regions, implicating it in inhibitor resistance mechanisms .

Recombinant Proteins

SupplierProduct CodeTagPurityApplication
CusabioCSB-EP015080DOQ1Undetermined>85%Western blot, ELISA
Creative BiomartRFL29637HFHis-tagN/AFunctional assays
MyBioSourceN/AN/A>85%Antibody development

ELISA Kits

  • Target: Bat MT-ND4L .

  • Sensitivity: Quantifies protein levels in mitochondrial extracts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Artibeus jamaicensis (Jamaican fruit-eating bat)
Target Names
Target Protein Sequence
MSLTYMNMFMAFTISLLGLLMYRSHMMSSLLCLEGMMLSLFVMMTITILNTHLTLASMLP IILLVFAACEAALGLSLLVMVSTTYGMDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological importance of MT-ND4L in Artibeus jamaicensis?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) in Artibeus jamaicensis functions as a critical component of complex I in the mitochondrial respiratory chain. As part of complex I, this protein facilitates the transfer of electrons from NADH to ubiquinone, generating an electrochemical gradient essential for ATP production through oxidative phosphorylation. The Jamaican fruit bat (Artibeus jamaicensis) is one of the most common bat species in tropical Americas and has been studied as a potential reservoir host for viruses like Tacaribe virus, making its mitochondrial proteins of particular interest . Studying MT-ND4L in this species provides insights into energy metabolism adaptations that may contribute to the bat's ability to serve as a viral reservoir without developing pathology.

How does Artibeus jamaicensis MT-ND4L compare to homologs in other species?

Comparative analysis of MT-ND4L sequences reveals significant conservation of functional domains across mammalian species while displaying species-specific variations. Research has demonstrated that MT-ND4L sequences can be effectively used in phylogenetic analyses to distinguish between species with common ancestry and separate distantly related species . In studies examining mitochondrial gene diversity, MT-ND4L has been used alongside other mitochondrial genes like 16S rRNA, 12S rRNA, COX3, and ATP6 for robust species identification and evolutionary relationship determination . When comparing bat MT-ND4L to human homologs, researchers have identified genes under positive selection through substitution rate estimation between these species, providing evolutionary insights into adaptation mechanisms .

What genetic variations have been documented in Artibeus jamaicensis MT-ND4L?

The transcriptome sequencing of Artibeus jamaicensis has revealed substantial genetic diversity in mitochondrial genes, including MT-ND4L. From the transcriptome analysis, more than 100,000 contigs were assembled with 25,000 functionally annotated genes, including MT-ND4L . Comparative studies between species have identified sequence variations that may influence protein function and efficiency. While specific SNPs in Artibeus jamaicensis MT-ND4L have not been extensively characterized, analogous studies in other species, such as cattle, have revealed significant associations between MT-ND4L variations and environmental adaptations (such as high-altitude adaptation) .

What expression systems are optimal for producing recombinant Artibeus jamaicensis MT-ND4L?

The expression protocol typically involves:

  • Codon optimization of the MT-ND4L sequence for the chosen expression system

  • Cloning into an appropriate vector with a strong inducible promoter and purification tag (e.g., His-tag)

  • Transformation into the expression host

  • Optimization of induction conditions (temperature, inducer concentration, duration)

  • Cell harvesting and membrane fraction isolation

Research involving recombinant proteins from Artibeus jamaicensis has demonstrated successful expression using standard molecular biology techniques, with transcriptome data providing essential sequence information for primer design and expression optimization .

How can researchers verify the structural integrity and functionality of purified recombinant MT-ND4L?

Verifying the structural integrity and functionality of purified recombinant Artibeus jamaicensis MT-ND4L requires multiple complementary approaches:

Structural Integrity Assessment:

  • SDS-PAGE and Western blotting to confirm molecular weight and antibody recognition

  • Circular dichroism (CD) spectroscopy to analyze secondary structure content

  • Limited proteolysis to evaluate folding quality

  • Size exclusion chromatography to assess oligomeric state

Functional Validation:

  • NADH:ubiquinone oxidoreductase activity assays measuring electron transfer rates

  • Reconstitution into liposomes to assess membrane integration

  • Complex I assembly assays when combined with other subunits

  • Membrane potential measurements in reconstituted systems

For reliable results, researchers should establish a baseline using available data from other mammalian MT-ND4L proteins. The transcriptome analysis of Artibeus jamaicensis provides valuable information about gene function and expression patterns that can guide functional assessment strategies .

How can recombinant Artibeus jamaicensis MT-ND4L be used to study viral-host interactions?

Recombinant Artibeus jamaicensis MT-ND4L provides a valuable tool for investigating mitochondrial involvement in viral-host interactions, particularly in understanding how bats serve as reservoir hosts without developing disease. Methodological approaches include:

  • Protein-Protein Interaction Studies: Using purified recombinant MT-ND4L in pull-down assays or co-immunoprecipitation experiments to identify interactions with viral proteins, particularly those from viruses known to infect Artibeus jamaicensis, such as Tacaribe virus .

  • Cellular Energy Metabolism Analysis: Comparing mitochondrial function in cells expressing wild-type versus mutant MT-ND4L during viral infection to assess if mitochondrial adaptations contribute to viral tolerance.

  • Immune Response Modulation: Investigating how MT-ND4L variants affect mitochondrial antiviral signaling protein (MAVS) pathways and subsequent type I interferon responses, which are key determinants of viral resistance in bats.

Research on Jamaican fruit bats has already identified 466 immune-related genes that may be relevant for studying viral infections, providing a foundation for investigating how mitochondrial proteins like MT-ND4L interact with the immune system during viral challenge . Additionally, studies on the bat's competence for viruses such as Ebola demonstrate the importance of understanding species-specific viral-host interactions .

What insights can recombinant Artibeus jamaicensis MT-ND4L provide about high-altitude or hypoxia adaptation?

Recombinant Artibeus jamaicensis MT-ND4L can serve as a comparative model for studying adaptation to hypoxic conditions. Although Jamaican fruit bats are not high-altitude specialists, comparing their MT-ND4L structure and function with those from high-altitude adapted species can reveal mechanisms of mitochondrial adaptation to oxygen limitation.

Methodological approaches include:

  • Comparative Functional Assays: Assessing the oxygen affinity and electron transfer efficiency of recombinant MT-ND4L from Artibeus jamaicensis versus high-altitude adapted species under varying oxygen tensions.

  • Site-Directed Mutagenesis: Introducing specific mutations observed in high-altitude species into recombinant Artibeus jamaicensis MT-ND4L to assess their functional impact.

  • ROS Production Measurement: Evaluating reactive oxygen species generation during electron transport under normal versus hypoxic conditions.

Studies of MT-ND4L in cattle have shown significant associations between specific SNPs and high-altitude adaptation. For example, SNPs m.9893 A>G, m.9932 A>C, and m.10155 C>T in MT-ND3 had negative associations with high-altitude adaptation, while SNP m.10073C>T was positively associated with high-altitude adaptation . Similar methodologies can be applied to bat MT-ND4L to understand evolutionary adaptations to environmental challenges.

How might studying Artibeus jamaicensis MT-ND4L mutations contribute to understanding human mitochondrial disorders?

Studying recombinant Artibeus jamaicensis MT-ND4L and its variants can provide valuable insights into human mitochondrial disorders through comparative functional analysis. Methodological approaches include:

  • Disease-Associated Mutation Modeling: Introducing human disease-associated mutations (such as those linked to Leber hereditary optic neuropathy) into recombinant bat MT-ND4L to assess functional consequences.

  • Compensatory Mechanism Identification: Investigating if bat MT-ND4L contains natural variants that might compensate for potentially damaging mutations through biochemical and structural studies.

  • Cross-Species Complex I Assembly Studies: Assessing the compatibility of bat MT-ND4L with human complex I subunits to understand structural constraints on assembly and function.

Research has identified mutations in MT-ND4L associated with human conditions such as Leber hereditary optic neuropathy. One specific mutation, T10663C or Val65Ala, changes a single amino acid in the protein (valine to alanine at position 65) . Additionally, studies have linked MT-ND4L mutations with other phenotypes, such as the MT-ND4L10550A→G mutation being associated with higher BMI and potential obesity risk factors . These findings provide a foundation for comparative studies using recombinant bat proteins.

What bioinformatic tools are most appropriate for analyzing Artibeus jamaicensis MT-ND4L sequence data?

The analysis of Artibeus jamaicensis MT-ND4L sequence data requires a comprehensive bioinformatic approach using specialized tools for mitochondrial gene analysis:

Sequence Analysis Tools:

  • MEGA X: For multiple sequence alignment, evolutionary distance calculation, and phylogenetic tree construction

  • MitoZ: Specialized for mitochondrial genome assembly and annotation

  • MitoAnnotator: For accurate annotation of mitochondrial genes

  • PAML: For detection of positive selection in mitochondrial genes

Structural Prediction Tools:

  • SWISS-MODEL: For homology modeling of MT-ND4L structure

  • TMHMM/TOPCONS: For transmembrane domain prediction

  • ConSurf: For evolutionary conservation analysis

Functional Prediction Tools:

  • PolyPhen-2/SIFT: For predicting functional effects of amino acid substitutions

  • MutPred2: For prediction of pathogenicity of amino acid substitutions

  • Mitomap: For comparison with known mitochondrial variants

Research on Jamaican fruit bat transcriptome has utilized similar tools to assemble and annotate over 100,000 contigs and 25,000 genes, demonstrating the effectiveness of modern bioinformatic approaches for analyzing bat genetic data . Phylogenetic analysis techniques have also been successfully applied to mitochondrial genes for species identification and evolutionary studies .

How should researchers interpret complex I activity assays when using recombinant Artibeus jamaicensis MT-ND4L?

Interpretation of complex I activity assays using recombinant Artibeus jamaicensis MT-ND4L requires careful consideration of multiple factors:

Methodological Considerations:

  • Baseline Establishment: Compare activity with established models (bovine/mouse complex I) under identical conditions

  • Detergent Effects: Account for the influence of detergent type and concentration on activity measurements

  • Temperature Sensitivity: Assess activity across a temperature range to account for species-specific thermal optima

  • Substrate Kinetics: Determine Km and Vmax values for NADH and ubiquinone to identify species-specific differences

Data Interpretation Framework:

ParameterExperimental ConditionInterpretation of Deviations
NADH oxidation rateStandard conditions (pH 7.4, 30°C)Higher rates may indicate adaptation for increased energy production
Proton pumping efficiencyReconstituted proteoliposomesChanges may reflect adaptations to metabolic demands
ROS productionVarying substrate concentrationsLower ROS may indicate evolved mechanisms for oxidative stress resistance
Inhibitor sensitivityRotenone titrationAltered sensitivity suggests structural differences at inhibitor binding sites

When interpreting results, researchers should consider that the relationship between mitochondrial function and ATP production involves the complex interplay of multiple enzyme complexes beyond just complex I . The unique ecological and physiological adaptations of Jamaican fruit bats may be reflected in species-specific enzymatic properties.

What statistical approaches are most appropriate for analyzing MT-ND4L mutations and their phenotypic associations?

When analyzing MT-ND4L mutations and their phenotypic associations, researchers should employ robust statistical methodologies tailored to mitochondrial genetic data:

For Mutation Detection and Characterization:

  • Heteroplasmy Quantification: Droplet Digital PCR has proven effective for precise quantification of mutation frequencies in MT-ND4L, as demonstrated in studies of the MT-ND4L10550A→G mutation

  • Sequence Variation Analysis: Maximum likelihood methods for phylogenetic analysis of sequence variations across different taxonomic groups

  • Population Genetics Metrics: FST, nucleotide diversity (π), and haplotype diversity calculations to assess genetic structure

For Phenotypic Association Studies:

  • Linear Mixed Models: To account for relatedness when assessing associations between MT-ND4L variants and continuous traits

  • Permutation Tests: For establishing significance thresholds specific to mitochondrial data

  • Bayesian Approaches: To incorporate prior knowledge about mitochondrial genetics

Example Statistical Workflow:

  • Establish mutation detection thresholds based on technical replicates

  • Normalize data to account for sequencing depth and quality

  • Apply appropriate statistical tests with correction for multiple testing

  • Validate findings through independent methodologies or cohorts

Studies examining MT-ND4L mutations have employed these approaches to identify significant associations with traits such as BMI and birth weight . Research on high-altitude adaptation has also successfully used statistical methods to identify significant associations between specific SNPs in mitochondrial genes and adaptive traits .

How can CRISPR-based methodologies be applied to study Artibeus jamaicensis MT-ND4L function?

While editing mitochondrial DNA directly with CRISPR remains challenging, several innovative approaches can be applied to study Artibeus jamaicensis MT-ND4L function:

  • Nuclear-encoded MT-ND4L Expression: Creating recombinant MT-ND4L with mitochondrial targeting sequences for expression from nuclear DNA, allowing standard CRISPR editing

  • Mitochondria-targeted Base Editors: Utilizing recently developed mitochondrial-targeted cytidine or adenine base editors to introduce specific point mutations

  • Mitochondrial Transcription Factor Modulation: Using CRISPR to modify nuclear genes that regulate mitochondrial gene expression

  • MitoTALENs Approach: Employing mitochondria-targeted transcription activator-like effector nucleases as an alternative to CRISPR for mitochondrial genome editing

These methodologies can help address fundamental questions about MT-ND4L function, such as how specific mutations affect mitochondrial complex I assembly, electron transport efficiency, and cellular responses to environmental stressors. The Jamaican fruit bat transcriptome dataset provides necessary sequence information for designing these precision gene editing approaches .

What role might Artibeus jamaicensis MT-ND4L play in aging and lifespan determination?

Investigating Artibeus jamaicensis MT-ND4L's potential role in aging and lifespan determination represents an exciting research frontier, particularly given that many bat species exhibit exceptional longevity relative to their body size. Methodological approaches include:

  • Comparative Aging Models: Contrasting MT-ND4L function in young versus aged bat tissues to identify age-related changes in complex I activity

  • Oxidative Damage Assessment: Measuring how MT-ND4L variants influence ROS production and oxidative damage accumulation with age

  • Mitochondrial Dynamics Studies: Evaluating how MT-ND4L affects mitochondrial fusion, fission, and mitophagy processes essential for maintaining mitochondrial health during aging

  • Metabolic Flexibility Analysis: Assessing how MT-ND4L contributes to metabolic switching between different energy substrates, a capacity often associated with longevity

Researchers have identified that mitochondrial function, particularly the efficiency of oxidative phosphorylation, plays a crucial role in determining lifespan across species . The unique adaptations of bat mitochondria may contribute to their exceptional longevity and disease resistance, making MT-ND4L an important target for aging research.

How might MT-ND4L variations contribute to Artibeus jamaicensis ecological adaptations?

MT-ND4L variations may play significant roles in the ecological adaptations of Artibeus jamaicensis, particularly regarding energy metabolism tailored to its fruit-based diet and flight capabilities. Methodological approaches to investigate these adaptations include:

  • Comparative Energetics: Measuring the bioenergetic efficiency of MT-ND4L variants under conditions mimicking different ecological challenges (fasting, flight, torpor)

  • Environmental Response Assays: Assessing how MT-ND4L function changes under varying temperature, pH, and oxygen conditions relevant to the bat's habitat

  • Diet-Specific Metabolic Adaptations: Investigating how MT-ND4L contributes to metabolic pathways specialized for processing fruit-based diets high in sugars

  • Population Genetics Across Habitats: Analyzing MT-ND4L sequence variations across different Artibeus jamaicensis populations from diverse ecological niches

Studies on other species have demonstrated that mitochondrial gene variations can be associated with adaptation to specific environmental conditions, such as high altitude . Similar principles can be applied to understand how MT-ND4L variations might contribute to the Jamaican fruit bat's successful adaptation to various ecological niches throughout the tropical Americas .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.