Recombinant Arvicanthis somalicus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for prioritized development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Arvicanthis somalicus (Neumann's grass rat) (Somali grass rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAAILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWTVPSLGLKTDAIPGRLN QATLSSNRPGLYYGQCSEICGSNHSFMPIVLEMVPLKYFENWSTSMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (in subunit 2) and heme a (in subunit 1) to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and CuB, reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Arvicanthis somalicus Cytochrome c oxidase subunit 2 and what is its biological significance?

Arvicanthis somalicus Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein that functions as a crucial component of the cytochrome c oxidase complex (Complex IV) in the electron transport chain. It is derived from Arvicanthis somalicus, commonly known as Neumann's grass rat or Somali grass rat . The protein plays an essential role in cellular respiration by catalyzing the reduction of oxygen to water, coupling this reaction to proton pumping across the inner mitochondrial membrane, which contributes to ATP synthesis .

What are the structural characteristics of recombinant MT-CO2 from Arvicanthis somalicus?

Recombinant MT-CO2 from Arvicanthis somalicus is a full-length protein consisting of 227 amino acids. Its amino acid sequence begins with MAYPFQLGLQDATSPIMEE and continues through to MPLKYFENWSTSMI at the C-terminus . The protein contains hydrophobic regions that anchor it to the mitochondrial inner membrane, consistent with its function as a membrane-spanning subunit of the cytochrome c oxidase complex . When expressed recombinantly, it can be tagged (commonly with a His-tag at the N-terminus) to facilitate purification and downstream applications .

How does recombinant MT-CO2 compare to native MT-CO2 in terms of structure and function?

Recombinant MT-CO2 aims to replicate the structural and functional properties of native MT-CO2, though several differences exist:

ParameterNative MT-CO2Recombinant MT-CO2
SourceIsolated from Arvicanthis somalicus mitochondriaExpressed in heterologous systems (e.g., E. coli)
Post-translational modificationsContains species-specific modificationsMay lack certain post-translational modifications
Protein foldingNatural folding in mitochondrial environmentFolding may differ depending on expression system
PurityMixed with other mitochondrial proteins>90% purity achieved through affinity purification
TagsNo exogenous tagsOften contains affinity tags (e.g., His-tag)

The functional equivalence between native and recombinant forms should be experimentally validated for specific research applications .

What are the optimal storage conditions for preserving recombinant MT-CO2 activity?

For optimal preservation of recombinant MT-CO2 activity, the following storage conditions are recommended:

  • Store lyophilized protein at -20°C or -80°C for long-term storage .

  • After reconstitution, store at -20°C with 50% glycerol to prevent freeze-thaw damage .

  • For working solutions needed within one week, store aliquots at 4°C to minimize freeze-thaw cycles .

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity and integrity .

  • Prior to opening, briefly centrifuge vials to collect all material at the bottom .

These conditions help maintain protein stability and enzymatic activity for experimental applications requiring functional MT-CO2 .

What reconstitution protocols are recommended for recombinant MT-CO2 to ensure optimal protein activity?

The recommended reconstitution protocol for lyophilized recombinant MT-CO2 involves:

  • Centrifuge the vial briefly before opening to collect all material at the bottom .

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For reconstitution of affinity-purified antibodies against MT-CO2, add 50 μl of sterile water .

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 50% .

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles .

This protocol ensures optimal solubilization while preserving the structural integrity and functional properties of the recombinant MT-CO2 protein .

How can researchers validate the purity and integrity of recombinant MT-CO2 preparations?

Researchers can validate recombinant MT-CO2 purity and integrity through multiple complementary approaches:

  • SDS-PAGE analysis: Should show a single predominant band at approximately 30 kDa, with purity >90% .

  • Western blot analysis: Using specific antibodies against MT-CO2 or the affinity tag to confirm identity .

  • Mass spectrometry: To verify the exact molecular weight and sequence coverage.

  • Activity assays: Measuring cytochrome c oxidase activity to confirm functional integrity.

  • Circular dichroism (CD) spectroscopy: To assess secondary structure integrity.

  • Dynamic light scattering (DLS): To evaluate homogeneity and detect potential aggregation.

When using antibodies for detection, a 1:1000 dilution is typically recommended for Western blot applications .

How can recombinant MT-CO2 be utilized in structural biology studies?

Recombinant MT-CO2 from Arvicanthis somalicus can be leveraged for various structural biology investigations:

  • X-ray crystallography: His-tagged recombinant MT-CO2 can be purified to high homogeneity required for crystallization trials .

  • Cryo-electron microscopy (cryo-EM): The protein can be reconstituted with other cytochrome c oxidase subunits to study the complete complex architecture.

  • Nuclear magnetic resonance (NMR) spectroscopy: For analyzing dynamic properties and interaction interfaces.

  • Molecular dynamics simulations: Using the amino acid sequence provided to predict structural features and conformational changes .

  • Protein-protein interaction studies: To map interactions with other components of the respiratory chain.

  • Structure-function relationship studies: By introducing site-directed mutations and analyzing their effects on protein folding and activity.

These approaches can provide insights into the species-specific structural features of Arvicanthis somalicus MT-CO2 compared to homologs from other organisms .

What are the challenges in expressing functional recombinant MT-CO2, and how can they be addressed?

Several challenges exist in expressing functional recombinant MT-CO2, along with potential solutions:

ChallengeDescriptionSolution Strategies
Membrane protein expressionMT-CO2 is naturally membrane-bound, making soluble expression difficultUse specialized E. coli strains; add solubility-enhancing tags; express in cell-free systems
Proper foldingMitochondrial proteins often require specific chaperonesCo-express with molecular chaperones; optimize expression temperature (typically lower temperatures)
Codon biasDifferences between Arvicanthis somalicus and expression host codon usageUse codon-optimized synthetic genes for the expression system
Post-translational modificationsNative modifications may be absent in bacterial expressionConsider eukaryotic expression systems for critical modifications
Protein toxicityOverexpression may be toxic to host cellsUse tightly regulated inducible promoters; optimize induction conditions
Protein aggregationTendency to form inclusion bodiesOptimize solubilization buffers with appropriate detergents; use fusion partners that enhance solubility

Successful expression typically requires empirical optimization of conditions specific to the research objectives .

How does MT-CO2 from Arvicanthis somalicus compare with homologs from other species in terms of sequence conservation and function?

MT-CO2 displays varying degrees of sequence conservation across species, reflecting both functional constraints and evolutionary adaptations:

  • High conservation in catalytic domains: The core functional regions involved in electron transfer and oxygen binding show strong conservation across mammals .

  • Species-specific variations: Regions exposed to the mitochondrial intermembrane space or matrix show higher variability, potentially reflecting adaptations to different cellular environments or metabolic requirements.

  • Comparative analysis with other rodents: Arvicanthis somalicus MT-CO2 shows high similarity to other rodent species, but with distinctive substitutions that may correlate with its adaptation to arid environments and metabolic characteristics.

  • Cross-reactivity with antibodies: Antibodies against plant COXII show cross-reactivity across diverse plant species but do not recognize MT-CO2 from all organisms, indicating significant structural divergence in some lineages .

These comparative studies provide insights into the evolution of mitochondrial respiratory complexes and species-specific adaptations .

What controls should be included when using recombinant MT-CO2 in experimental studies?

When designing experiments with recombinant MT-CO2, the following controls should be incorporated:

  • Negative controls:

    • Buffer-only controls to establish baseline measurements

    • Irrelevant proteins of similar size and tag configuration

    • Heat-denatured MT-CO2 to distinguish between specific and non-specific effects

  • Positive controls:

    • Commercial cytochrome c oxidase preparations (if measuring enzymatic activity)

    • Previously validated MT-CO2 preparations with known activity

    • Native mitochondrial preparations containing endogenous MT-CO2

  • Specificity controls:

    • Competitive inhibition with known cytochrome c oxidase inhibitors

    • Antibody blocking experiments in immunological applications

    • Tag-only protein constructs to distinguish tag-mediated from MT-CO2-mediated effects

These controls help validate experimental findings and distinguish specific biological effects from technical artifacts .

What are common pitfalls in recombinant MT-CO2 experiments and how can researchers avoid them?

Several common pitfalls can compromise recombinant MT-CO2 experiments:

PitfallManifestationPrevention Strategy
Protein degradationMultiple bands on Western blot; reduced activityAdd protease inhibitors; maintain cold chain; minimize freeze-thaw cycles
AggregationVisible precipitates; loss of activityOptimize buffer composition; add stabilizing agents; centrifuge before use
Non-specific bindingHigh background in binding assaysInclude detergents or blocking agents; use stringent washing protocols
Tag interferenceActivity differences between tagged and untagged proteinInclude tag-only controls; compare multiple tag positions; consider tag removal
Improper reconstitutionPoor solubility; inconsistent resultsFollow recommended reconstitution protocols precisely
Endotoxin contaminationInflammatory responses in cell-based assaysUse endotoxin removal procedures for E. coli-expressed proteins
Buffer incompatibilityPrecipitation; loss of activityTest buffer compatibility before experiments; perform small-scale pilot studies

Careful experimental planning and rigorous control experiments can help identify and mitigate these common issues .

How can researchers quantitatively assess cytochrome c oxidase activity of recombinant MT-CO2?

Quantitative assessment of recombinant MT-CO2 cytochrome c oxidase activity can be performed using several complementary approaches:

  • Spectrophotometric assays:

    • Monitoring the oxidation of reduced cytochrome c at 550 nm

    • Following oxygen consumption using oxygen-sensitive electrodes or fluorescent probes

    • Measuring the reduction of artificial electron acceptors

  • Polarographic methods:

    • Using Clark-type oxygen electrodes to measure oxygen consumption rates

    • Calculating enzyme kinetic parameters (Km, Vmax) under various substrate concentrations

  • Activity in reconstituted systems:

    • Incorporating recombinant MT-CO2 into liposomes or nanodiscs

    • Measuring proton pumping using pH-sensitive dyes

    • Assessing membrane potential generation with potential-sensitive fluorescent probes

  • Data analysis considerations:

    • Normalize activity to protein concentration

    • Account for temperature and pH dependencies

    • Compare activities to reference standards (e.g., bovine heart cytochrome c oxidase)

These methodologies allow researchers to quantitatively characterize the functional properties of recombinant MT-CO2 preparations .

How can MT-CO2 be utilized in studies of mitochondrial dysfunction and related diseases?

Recombinant MT-CO2 offers valuable applications in studying mitochondrial dysfunction:

  • Structural templates: Recombinant protein can serve as a structural template for modeling human MT-CO2 mutations associated with mitochondrial diseases.

  • Antibody development: Using recombinant MT-CO2 to generate specific antibodies for detecting altered expression or localization in disease models .

  • Enzyme replacement studies: Evaluating the potential of recombinant MT-CO2 to restore function in cellular models with cytochrome c oxidase deficiency.

  • Drug screening platforms: Establishing in vitro assays with recombinant MT-CO2 to screen compounds that modulate cytochrome c oxidase activity.

  • Comparative studies: Investigating species-specific differences in MT-CO2 structure and function that may provide insights into variable disease susceptibility.

  • Aging research: Exploring the role of MT-CO2 modifications in age-related mitochondrial dysfunction, using the recombinant protein as a reference standard.

These applications contribute to understanding the molecular basis of mitochondrial diseases and developing potential therapeutic strategies .

What methods can be used to study the interaction of MT-CO2 with other components of the respiratory chain?

Researchers can employ multiple methodologies to investigate MT-CO2 interactions with other respiratory chain components:

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against MT-CO2 or its interaction partners

    • Identifying novel interaction partners through mass spectrometry analysis of Co-IP complexes

  • Blue Native PAGE (BN-PAGE):

    • Resolving intact respiratory chain complexes under native conditions

    • Detecting MT-CO2-containing complexes using specific antibodies at 1:1000 dilution

  • Surface plasmon resonance (SPR):

    • Measuring binding kinetics and affinities between recombinant MT-CO2 and other purified components

    • Determining effects of mutations or post-translational modifications on interaction strengths

  • Crosslinking mass spectrometry:

    • Identifying specific contact points between MT-CO2 and other proteins

    • Mapping the interaction interface at amino acid resolution

  • Microscopy techniques:

    • Fluorescence resonance energy transfer (FRET) to detect proximity between labeled proteins

    • Super-resolution microscopy to visualize co-localization in mitochondrial membranes

These approaches provide complementary insights into the dynamic assembly and function of respiratory chain complexes involving MT-CO2 .

What emerging technologies are enhancing research with recombinant MT-CO2?

Several cutting-edge technologies are advancing research capabilities with recombinant MT-CO2:

  • CRISPR/Cas9 genome editing:

    • Introducing mutations in endogenous MT-CO2 genes to study function

    • Creating cellular models with humanized MT-CO2 sequences for comparative studies

  • Single-molecule techniques:

    • Measuring enzymatic activity at the single-molecule level

    • Observing conformational changes during catalytic cycles

  • Cryo-electron tomography:

    • Visualizing MT-CO2 in its native membrane environment

    • Mapping the spatial organization of respiratory complexes in mitochondria

  • Protein engineering approaches:

    • Designing MT-CO2 variants with enhanced stability or altered substrate specificity

    • Creating fusion proteins for specialized applications

  • Computational methods:

    • Molecular dynamics simulations of MT-CO2 within membrane environments

    • Machine learning approaches to predict functional consequences of sequence variations

  • Synthetic biology:

    • Reconstituting minimal respiratory chains with defined components

    • Engineering artificial electron transport systems incorporating modified MT-CO2

These emerging technologies expand the experimental toolkit available for investigating the structure, function, and regulation of MT-CO2 in fundamental and applied research contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.