Recombinant Ascaris suum ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methodology

The recombinant ATP6 protein is synthesized in E. coli using plasmid vectors optimized for high-yield expression. After induction with isopropyl β-D-1-thiogalactopyranoside (IPTG), the protein is purified via immobilized metal affinity chromatography (IMAC) leveraging the His tag . While specific protocols are not detailed in available literature, standard recombinant protein production workflows are inferred, including:

  1. Cell Lysis: Mechanical or chemical disruption of bacterial cells.

  2. Affinity Chromatography: Binding of the His-tagged protein to nickel or cobalt resins.

  3. Elution: Release of purified ATP6 using imidazole buffers.

This approach ensures high purity and stability for downstream applications .

Research Applications of Recombinant ATP6

  1. Antibody Development: Used as an antigen to generate antibodies for detecting ATP6 in parasitic infections .

  2. Enzyme Activity Assays: Measures proton transport efficiency in synthetic lipid bilayers or mitochondrial membranes .

  3. Structural Studies: Facilitates cryo-EM or X-ray crystallography to resolve ATP synthase architecture .

  4. Drug Discovery: Screens for antihelminthic compounds targeting ATP synthase in parasites .

Challenges and Future Directions

Current limitations include the lack of Ascaris suum-specific functional studies, necessitating extrapolation from yeast or human models . Future work could focus on:

  • Cryo-EM Structures: Resolving ATP6’s role in Ascaris suum ATP synthase dimerization.

  • Mutagenesis Studies: Testing conserved residues (e.g., arginine in helix 5) for proton translocation efficiency .

  • Parasite Metabolism: Investigating ATP6 as a drug target to disrupt nematode bioenergetics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
Target Names
ATP6
Target Protein Sequence
MTNVYFLDIFMFVYVLQFLFYFKESMLGVLVNKFLGLLVVVFSYTDSLPLSSVISVFTFL VLLTCCFGGYFMYSFCPCGMIEFTFVYAMVAWLSTLLTFITSEKFSIYISKAGDSFLKTF SMLLVELVSEVSRPLALTVRLTVNVLVGHVISMMLYQLLELYLGIFYVWIVVLAIVMECF VFFIQSYIFSRLIYLYLNE
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is produced by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. As a key component of the proton channel, subunit a may play a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (ATP6) and what is its function in Ascaris suum?

ATP synthase subunit a (ATP6) is an essential component of the ATP synthase complex (Complex V) in mitochondria. In Ascaris suum, this membrane protein forms part of the F0 portion of ATP synthase, creating a proton channel that allows positively charged particles (protons) to flow across the mitochondrial membrane . This proton flow drives the rotary mechanism that enables the conversion of ADP to ATP in the final step of oxidative phosphorylation . The Ascaris suum ATP6 protein consists of 199 amino acids and plays a crucial role in energy production within this parasitic roundworm . As part of the complete ATP synthase enzyme, ATP6 contributes to proton-transporting ATP synthase activity through a rotational mechanism .

How does recombinant Ascaris suum ATP6 differ from native ATP6 in structure and function?

Recombinant Ascaris suum ATP6, such as the commercially available His-tagged version, includes modifications that distinguish it from the native protein:

  • Addition of affinity tags: The recombinant version typically contains an N-terminal His-tag to facilitate purification .

  • Expression system differences: While native ATP6 is produced within Ascaris suum mitochondria, recombinant versions are typically expressed in heterologous systems like E. coli .

  • Post-translational modifications: The recombinant protein may lack organism-specific post-translational modifications that occur in the native environment.

  • Buffer composition: Recombinant proteins are maintained in artificial buffer systems (such as Tris/PBS-based buffer with 6% Trehalose, pH 8.0) rather than the native mitochondrial membrane environment .

Despite these differences, the core amino acid sequence remains identical, and the recombinant protein is designed to maintain the functional domains necessary for research applications .

What expression systems are commonly used for producing recombinant Ascaris suum ATP6?

E. coli is the predominant expression system for producing recombinant Ascaris suum ATP6, as evidenced by commercially available products . This bacterial expression system offers advantages including:

  • Rapid growth and high protein yield

  • Well-established protocols for genetic manipulation

  • Cost-effective production at scale

  • Simplified purification when combined with affinity tags

What are the optimal storage conditions for recombinant Ascaris suum ATP6?

Based on manufacturer recommendations, the optimal storage conditions for recombinant Ascaris suum ATP6 include:

Storage ParameterRecommendation
Long-term storage temperature-20°C to -80°C
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
Cryoprotectant5-50% glycerol (50% is commonly used)
Physical formLyophilized powder or aliquoted solution
Working storage4°C for up to one week
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For optimal results, researchers should centrifuge vials briefly before opening to bring contents to the bottom .

How can the purity of recombinant Ascaris suum ATP6 be assessed?

The purity of recombinant Ascaris suum ATP6 can be assessed using several complementary techniques:

  • SDS-PAGE: Standard method showing greater than 90% purity for commercial preparations; appears as a single band at the expected molecular weight .

  • Western blotting: Using antibodies specific to either ATP6 or the His-tag to confirm identity while assessing purity.

  • Mass spectrometry: For precise analysis of protein mass and potential contaminants.

  • Size exclusion chromatography: To evaluate whether the protein exists as monomers or aggregates.

  • Circular dichroism: To assess proper folding through secondary structure analysis.

For membrane proteins like ATP6, additional methods to assess functional integrity may include reconstitution into liposomes followed by functional assays that measure aspects of ATP synthesis or proton transport.

How can researchers measure ATP synthesis activity of recombinant Ascaris suum ATP6?

Measuring ATP synthesis activity requires incorporating recombinant ATP6 into a functional ATP synthase complex, as ATP6 alone cannot catalyze ATP synthesis. Research approaches include:

  • Reconstitution assays: Incorporating the recombinant ATP6 into liposomes along with other necessary ATP synthase subunits to create a minimal functional complex.

  • Substrate preference analysis: Comparing ATP synthesis rates using different substrates (malate versus succinate) can characterize functional properties .

  • Proton gradient establishment: Creating an artificial proton gradient across membranes containing the reconstituted complex.

  • ATP detection methods:

    • Luciferase-based luminescence assays for sensitive ATP quantification

    • HPLC-based detection of ATP production

    • Radiolabeled substrate incorporation

Evidence from MT-ATP6 variant studies shows that decreased ATP synthesis is a common biochemical feature in pathogenic variants, making this a critical parameter to measure .

What mutations in ATP6 affect protein function and how can they be studied in Ascaris suum?

While specific Ascaris suum ATP6 mutations aren't detailed in the search results, studies of human MT-ATP6 mutations provide a framework for investigating them:

Mutation ExampleFunctional EffectsPotential Research Approach
m.8993T>GImpairs ATP synthesis and oxidative phosphorylation Create equivalent mutation in Ascaris suum ATP6
m.9176T>GDecreased ATP synthesis, normal response to oligomycin, increased mitochondrial membrane potential Structure-function analysis of proton pumping
m.9185T>CDecreased membrane potential, impaired complex assembly, variable effects on ATP hydrolysis Study equivalent positions in Ascaris ATP6

Research approaches should include:

  • Site-directed mutagenesis at conserved residues

  • Functional assays comparing wild-type and mutant proteins

  • Structural modeling to predict effects of mutations

  • Heterologous expression systems to assess phenotypic effects

Understanding these mutations can provide insights into structure-function relationships in ATP6 across species .

How does the structure of ATP6 contribute to its proton pumping function?

ATP6 forms a critical part of the proton channel in ATP synthase that couples proton flow to ATP production. Key structural features include:

  • Transmembrane helices: ATP6 contains multiple transmembrane domains that span the inner mitochondrial membrane, forming part of the proton-conducting pathway .

  • Conserved residues: Specific amino acids within these transmembrane regions are crucial for proton translocation.

  • Interaction surfaces: Regions that interface with other F0 subunits to form the complete proton channel.

The 199-amino acid sequence of Ascaris suum ATP6 consists of highly hydrophobic segments arranged to create a proton-conducting pathway . The protein's structure allows it to harness the energy from proton movement across the membrane to drive the conformational changes in ATP synthase that facilitate ATP production . Mutations that disrupt this structure can lead to impaired proton pumping efficiency while potentially preserving other aspects of ATP synthase function .

What approaches can be used to study ATP6 interactions with other ATP synthase subunits?

Researchers can investigate ATP6 interactions with other ATP synthase subunits using these approaches:

  • Co-immunoprecipitation: Using antibodies against ATP6 or other subunits to isolate protein complexes and identify interacting partners.

  • Crosslinking studies: Chemical crosslinking can capture transient interactions between neighboring subunits.

  • FRET (Förster Resonance Energy Transfer): By labeling ATP6 and potential partners with appropriate fluorophores to detect proximity-based energy transfer.

  • Cryo-electron microscopy: Visualizing the assembled complex at near-atomic resolution to determine the precise positioning of ATP6.

  • Yeast two-hybrid systems: Modified for membrane proteins to detect protein-protein interactions in vivo.

  • Mutagenesis studies: Systematic mutation of residues followed by assembly assays to identify critical interaction sites.

Understanding these interactions is crucial, as evidence suggests that some disease-causing mutations affect the stability or assembly of the ATP synthase complex rather than directly affecting catalytic function .

How do heteroplasmy levels affect ATP6 function and experimental design?

Heteroplasmy—the presence of both mutant and wild-type mitochondrial DNA within cells—significantly impacts ATP6 function and must be considered in experimental design:

  • Threshold effects: Studies of MT-ATP6 mutations show that symptoms typically appear when heteroplasmy levels exceed a certain threshold, with symptomatic subjects showing "significantly higher heteroplasmy load" .

  • Tissue specificity: Heteroplasmy levels can vary between tissues, affecting the manifestation of ATP6 dysfunction.

  • Experimental considerations:

    • When modeling ATP6 mutations, researchers should create systems with controlled heteroplasmy levels

    • Experiments should include multiple heteroplasmy percentages to determine threshold effects

    • Functional assays should correlate results with precise heteroplasmy measurements

Despite extensive overlap in heteroplasmy levels between symptomatic and asymptomatic individuals, statistical analysis shows significant differences between these groups . This highlights the importance of carefully controlled heteroplasmy levels in experimental systems studying ATP6 function.

What controls should be included when assessing the functional activity of recombinant Ascaris suum ATP6?

When assessing recombinant Ascaris suum ATP6 function, researchers should include these essential controls:

  • Positive control: Well-characterized ATP synthase complex known to be fully functional.

  • Negative control: ATP synthase complex without ATP6 or with non-functional ATP6 mutant.

  • Inhibitor controls: Test with oligomycin, which specifically binds to the F0 sector containing ATP6 .

  • Substrate controls: Test different substrates (malate vs. succinate) to characterize functional properties .

  • Tag-effect control: Compare tagged versus untagged versions to assess whether the His-tag affects function .

  • Directional controls: Measure both ATP synthesis and hydrolysis activities.

  • Membrane potential controls: Monitor membrane potential changes, as abnormal potential is associated with some ATP6 variants .

These controls ensure that observed functional properties can be correctly attributed to the recombinant Ascaris suum ATP6 protein rather than experimental artifacts or contaminating proteins.

How can researchers design experiments to investigate specific amino acid residues in ATP6?

To investigate specific amino acid residues in Ascaris suum ATP6, researchers should design experiments using these approaches:

  • Site-directed mutagenesis: Systematically change specific amino acids (especially conserved residues) to alanine or residues with different properties.

  • Disease-associated mutation modeling: Introduce mutations equivalent to human MT-ATP6 disease-causing mutations (like T8993G) into corresponding positions in Ascaris suum ATP6 .

  • Conservation analysis: Compare the Ascaris suum ATP6 sequence with ATP6 from other species to identify functionally important conserved residues .

  • Structure-guided mutagenesis: Target residues predicted to be involved in proton translocation or subunit interactions.

  • Comprehensive functional analysis for each mutant:

    • ATP synthesis measurement

    • Proton pumping efficiency

    • ATP hydrolysis activity

    • Complex assembly analysis

    • Mitochondrial membrane potential measurement

The complete 199-amino acid sequence of Ascaris suum ATP6 provided in product specifications provides an excellent starting point for identifying residues of interest .

What methods can be used to study the assembly of ATP synthase containing recombinant Ascaris suum ATP6?

Studying ATP synthase assembly with recombinant Ascaris suum ATP6 requires specialized approaches:

  • Blue Native PAGE: To visualize intact ATP synthase complexes and sub-complexes at different assembly stages.

  • Sucrose gradient ultracentrifugation: To separate fully assembled complexes from intermediate assemblies.

  • Co-immunoprecipitation: Using antibodies against ATP6 or other subunits to assess which components successfully associate.

  • FRET-based assembly assays: Monitoring real-time assembly using fluorescently labeled subunits.

  • Crosslinking followed by mass spectrometry: To identify interaction partners during assembly.

  • Pulse-chase experiments: To track the kinetics of complex assembly over time.

  • Reconstitution systems: Creating minimal systems with defined components to study assembly requirements.

Evidence from MT-ATP6 variant studies shows that some mutations specifically impair complex assembly, highlighting the importance of this process . For m.9185T>C, impaired CV holoenzyme assembly was observed in 2 out of 4 cases tested, demonstrating how mutations can disrupt proper complex formation .

How can researchers differentiate between ATP synthesis and hydrolysis effects when studying ATP6?

Differentiating between effects on ATP synthesis versus hydrolysis requires specialized experimental approaches:

  • Directional assays:

    • ATP synthesis: Establishing a proton gradient, adding ADP+Pi, and measuring ATP production

    • ATP hydrolysis: Adding ATP and measuring Pi release or ADP production

  • Specific readouts for each direction:

    • Synthesis: Luciferase-based ATP detection or radiolabeled ATP formation

    • Hydrolysis: Malachite green assay for phosphate release or coupled enzyme assays

  • Inhibitor studies:

    • Oligomycin affects both directions by blocking proton translocation through F0/ATP6

    • Compare inhibition patterns between synthesis and hydrolysis

  • Proton gradient manipulation:

    • Varying gradient strength can help determine if defects relate to proton translocation (ATP6-related) versus catalytic conversion

Research on MT-ATP6 variants shows that some mutations specifically affect synthesis while preserving hydrolysis capacity or vice versa . For example, the m.9176T>G mutation shows decreased ATP synthesis but normal response to oligomycin, while m.9185T>C shows decreased ATP hydrolysis in 3 out of 5 cases studied .

What approaches can investigate environmental effects on Ascaris suum ATP6 function?

To investigate environmental effects on Ascaris suum ATP6 function, researchers should consider:

  • pH variation studies: Test function across pH ranges to determine optimal conditions and sensitivity, relevant to the parasite's environment within the host.

  • Temperature sensitivity analysis: Assess function at temperatures spanning both mammalian host body temperature and environmental conditions eggs might experience.

  • Oxygen level experiments: Test ATP6 function under varying oxygen concentrations, reflecting the parasite's adaptation to potentially hypoxic environments.

  • Metabolite effects: Examine how host-derived metabolites affect ATP6 function, potentially revealing adaptation to the host environment.

  • Redox state manipulation: Alter redox conditions to mimic oxidative stress and measure effects on ATP6 function.

  • Comparative studies with host ATP6: Compare environmental sensitivity of parasite versus host (pig or human) ATP6 to identify parasite-specific adaptations.

  • Lipid environment manipulation: Test function in different membrane compositions to determine optimal lipid requirements.

These studies can provide insights into how Ascaris suum ATP6 has evolved for its parasitic lifestyle and potentially identify vulnerability points for therapeutic targeting.

How should researchers interpret changes in mitochondrial membrane potential with ATP6 variants?

Interpreting changes in mitochondrial membrane potential (ΔΨm) in the context of ATP6 variants requires careful analysis:

  • Direction of change: Abnormally increased mitochondrial membrane potential was observed with some MT-ATP6 variants (like m.9176T>G), while decreased potential was seen with others (m.9185T>C) . These opposing effects reflect different mechanisms of ATP6 dysfunction.

  • Mechanistic implications:

    • Increased ΔΨm typically indicates reduced proton flux through ATP synthase, suggesting ATP6 dysfunction impairs proton channel activity

    • Decreased ΔΨm may indicate proton leak or broader mitochondrial dysfunction

  • Correlation with other parameters:

    • Compare ΔΨm changes with ATP synthesis rates

    • Assess whether changes in ΔΨm predict functional impairment

  • Experimental considerations:

    • Different measurement techniques (fluorescent dyes vs. electrode-based) have varying sensitivities

    • Measurements should be performed under standardized conditions

The divergent effects on membrane potential highlight the complex relationship between ATP6 structure and function, requiring researchers to correlate membrane potential changes with other functional parameters for complete interpretation .

What analytical approaches help resolve data inconsistencies in ATP6 functional studies?

To address data inconsistencies in ATP6 functional studies, researchers should implement:

  • Standardized protocols:

    • Develop detailed protocols for protein preparation, reconstitution, and activity assays

    • Document all experimental conditions precisely

  • Quality control measures:

    • Establish protein purity thresholds (>90% by SDS-PAGE)

    • Verify protein integrity before functional testing

  • Multiple measurement techniques:

    • Use complementary methods to cross-validate results

    • Apply different substrate conditions (malate vs. succinate)

  • Statistical approaches:

    • Implement appropriate statistical tests for variability analysis

    • Use larger sample sizes to improve statistical power

    • Apply outlier detection methods when justified

  • Comprehensive reporting:

    • Document heteroplasmy levels when studying mutations

    • Report raw data alongside processed results

Research on MT-ATP6 variants demonstrates "extensive heterogeneity" in biochemical features, with "no single biochemical feature universally observed" . This inherent variability necessitates robust analytical approaches to distinguish true biological differences from experimental inconsistencies.

How can structure-function relationships in ATP6 be accurately determined?

Accurately determining structure-function relationships in ATP6 requires integrated approaches:

  • Sequence-structure analysis:

    • Analyze the complete 199-amino acid sequence of Ascaris suum ATP6

    • Identify conserved regions across species that likely have functional importance

    • Use computational approaches to predict structural features

  • Systematic mutagenesis:

    • Create targeted mutations in conserved residues

    • Test mutations equivalent to known disease-causing variants (like T8993G)

    • Assess multiple functional parameters for each variant

  • Integration with biochemical data:

    • Correlate structural features with biochemical properties like ATP synthesis, proton pumping, and membrane potential

    • Consider how mutations affecting specific domains influence different aspects of function

  • Avoid common pitfalls:

    • Remember ATP6 functions as part of a multi-subunit complex

    • Consider the membrane environment's influence on structure

    • Acknowledge that different mutations can affect function through distinct mechanisms

The search results highlight that MT-ATP6 variants show diverse biochemical features, suggesting complex structure-function relationships that require comprehensive characterization approaches .

How do heteroplasmy levels influence the interpretation of experimental results with ATP6 variants?

Heteroplasmy levels significantly impact the interpretation of ATP6 variant studies:

  • Threshold effects:

    • Symptomatic subjects had "significantly higher heteroplasmy load" despite "extensive overlap in heteroplasmy levels" between symptomatic and asymptomatic individuals

    • Functional defects may only appear above certain heteroplasmy thresholds

  • Quantitative relationships:

    • The severity of biochemical abnormalities often correlates with heteroplasmy percentage

    • Statistical analysis should account for heteroplasmy as a continuous variable

  • Data interpretation challenges:

    • Similar heteroplasmy levels may produce different phenotypes due to other genetic or environmental factors

    • Tissue-specific heteroplasmy differences may explain variable experimental results

  • Experimental design considerations:

    • Precisely measure and report heteroplasmy levels in all experiments

    • Include samples with a range of heteroplasmy levels to establish dose-response relationships

    • Consider using cybrid cell lines with controlled heteroplasmy to standardize experiments

Understanding the complex relationship between heteroplasmy and functional effects is essential for accurate interpretation of ATP6 variant studies and development of consistent diagnostic approaches .

How can researchers translate in vitro findings to understand ATP6 function in living organisms?

Translating in vitro findings about Ascaris suum ATP6 to its biological role requires bridging laboratory and organismal biology:

  • Comparative approaches:

    • Compare ATP6 structure and function between Ascaris suum and related nematodes

    • Correlate in vitro properties with the parasite's environmental adaptations

  • Life cycle considerations:

    • Examine ATP6 function across different life stages of Ascaris suum

    • Investigate how energy production requirements change during host infection

  • Physiological context:

    • Consider how ATP6 function relates to the parasite's unique oxygen requirements

    • Examine temperature sensitivity relevant to host environment

  • Evolutionary perspective:

    • Analyze how ATP6 sequence and function may have evolved specific adaptations for parasitic lifestyle

    • Compare with free-living nematode ATP6 for insight into specialized functions

  • Therapeutic implications:

    • Identify differences between parasite and host ATP6 that could be targeted

    • Correlate in vitro drug sensitivity with whole-organism effects

By connecting molecular mechanisms to organismal biology, researchers can develop a comprehensive understanding of how ATP6 contributes to Ascaris suum survival and potentially identify vulnerabilities for therapeutic intervention .

What are the most important considerations for researchers working with recombinant Ascaris suum ATP6?

Researchers working with recombinant Ascaris suum ATP6 should prioritize:

  • Protein quality: Ensure high purity (>90% by SDS-PAGE) and proper folding before functional studies .

  • Environmental conditions: Maintain optimal buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) and storage conditions (-20°C/-80°C with glycerol) .

  • Comprehensive functional assessment: Evaluate multiple parameters including ATP synthesis, ATP hydrolysis, proton pumping, and membrane potential effects, as "no single biochemical feature was universally observed" across ATP6 variants .

  • Context consideration: Remember that ATP6 functions as part of the larger ATP synthase complex and requires appropriate reconstitution for meaningful functional studies.

  • Comparative approach: Relate findings to known disease-associated mutations in human MT-ATP6 while accounting for species-specific differences .

  • Methodological rigor: Implement standardized protocols, appropriate controls, and robust statistical analyses to address the "extensive heterogeneity" observed in ATP6 functional studies .

By addressing these considerations, researchers can generate reliable and meaningful data about this important component of mitochondrial energy production in a significant parasitic organism.

What future research directions might advance understanding of ATP6 function?

Future research directions to advance understanding of ATP6 function include:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.