Recombinant Ascaris suum Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ascaris suum Cytochrome c Oxidase Subunit 2 (COII)

Recombinant Ascaris suum Cytochrome c oxidase subunit 2 (COII) is a bioengineered protein derived from the mitochondrial respiratory complex IV of the pig roundworm Ascaris suum. This protein is critical for electron transport in the mitochondrial inner membrane, facilitating the transfer of electrons from cytochrome c to oxygen, a process essential for ATP synthesis . The recombinant form is produced in E. coli and includes an N-terminal His tag for purification, enabling high-purity applications in biochemical research .

Production and Applications

Production Process:

  • Expression System: E. coli for cost-effective, high-yield production .

  • Purification: Affinity chromatography leveraging the His tag, followed by lyophilization .

  • Form: Lyophilized powder with 50% glycerol for stability .

Key Applications:

  • SDS-PAGE Analysis: Used to verify protein integrity and purity .

  • Biochemical Studies: Potential utility in investigating mitochondrial electron transport mechanisms or protein-protein interactions in parasitic organisms .

Comparisons with Human COII

ParameterAscaris suum COIIHuman COII (MT-CO2)
Gene LocationMitochondrial genomeMitochondrial DNA (p-arm)
Copper CenterCuA center (Cys196/Cys200, His204)CuA center (Cys196/Cys200, His204)
Protein Length232 amino acids227 amino acids
Expression SystemE. coli (recombinant)Native mitochondrial production
RoleElectron transfer in parasitic respirationATP synthesis in human mitochondria

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your requirements during order placement for preferential processing.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
Target Names
COII
Target Protein Sequence
MNNFFQDFNLLFSSSLFSSYMDWFYNFNCSLLFGVLSFVSTMFVYLLLSSFYFKSKKIEY QFGELLCSVFPTLILVMQMVPSLSLLYYYGLMNLDSSLTVKVTGHQWYWSYEFSDIPGLE FDSYMKSLDQLELGEPRLLEVDNRCVVPCDVNIRFCITSGDVIHSWALPSMSIKLDAMSG ILSTLSYSFPVVGVFYGQCSEICGANHSFMPVALEVTLLDNFKSWCVGLLSD
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, composed of three multi-subunit complexes (succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV)), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COII plays a critical role in this process by catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (heme a3 and CuB) in subunit 1. Here, molecular oxygen is reduced to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (COII) in Ascaris suum and what is its significance in molecular studies?

Cytochrome c oxidase subunit 2 (COII, also referred to as cox2) is a mitochondrial gene that encodes a critical component of the electron transport chain in Ascaris suum. This gene exhibits key characteristics that make it valuable for molecular studies, including a high degree of sequence conservation with specific variable regions suitable for species discrimination. COII in A. suum demonstrates a typical mitochondrial nucleotide composition with an AT bias (approximately 66.5%), which is characteristic of nematode mitochondrial genes . This gene contains specific conserved regions that can be used for taxonomic classification and phylogenetic analysis, particularly in distinguishing between closely related ascaridoid nematodes. COII sequences have proven valuable for exploring evolutionary relationships within the Ascaridoidea superfamily, as they maintain sufficient variation to allow species discrimination while remaining conserved enough to permit reliable amplification across diverse taxa .

How does A. suum COII sequence compare with related ascaridoid species?

Comparative analysis of A. suum COII sequences with other ascaridoid species reveals both conserved regions and specific variable sites that are valuable for taxonomic differentiation. Studies have shown that among the conserved base sites of cox2, some are specific to particular genera (e.g., 9 sites specific to Toxocara and 3 specific to Toxascaris) . The sequence alignment of A. suum COII with related species reveals approximately 135 parsimony-informative sites within the 582 bp gene fragment commonly used in molecular studies . This level of sequence variation makes COII suitable for distinguishing between closely related species, such as A. suum and A. lumbricoides, which show significant genetic similarity across their genomes. Molecular evidence suggests that A. suum and A. lumbricoides are genetically very closely related, possibly forming a species complex capable of interbreeding, with approximately 99% genomic identity in some studies . This close relationship is further supported by mitochondrial genome analyses, which have demonstrated high sequence similarity between these parasites traditionally considered host-specific to pigs and humans, respectively .

What are the recommended methods for isolation and initial characterization of A. suum COII gene?

The isolation of A. suum COII gene requires careful sample collection and processing protocols. Here is a recommended methodological approach:

  • Sample Collection: Obtain adult A. suum specimens from infected hosts (typically pigs or humans). Worms should be collected within 3 hours and maintained in Ascaris Ringers Solution (13.14 mM NaCl, 9.47 mM CaCl₂, 7.83 mM MgCl₂, 12.09 mM Tris, 99.96 mM NaC₂H₃O₂, 19.64 mM KCl, pH 7.8) at 37°C until use .

  • DNA Extraction: Excise a small piece of tissue from the worm, preferably from muscle tissue, and extract genomic DNA using standard protocols.

  • PCR Amplification: Amplify the COII gene using PCR with the following primers:

    • Forward: 5′-CAC CAA CTC TTA AAA TTA TC-3′

    • Reverse: 5′-TTT TCT AGT TAT ATA GAT TGR TTT YAT-3′

  • PCR Reaction Conditions:

    • Prepare 50 μl reaction mixture containing:

      • 25 μl 2× Taq PCR MasterMix

      • 3 μl genomic DNA

      • 16 μl sterile water

      • 3 μl of each primer (10 pmol/μl)

    • Thermal cycling conditions:

      • Initial denaturation at 94°C for 5 min

      • 35 cycles of:

        • Denaturation at 94°C for 30 s

        • Annealing at 44°C for 30 s

        • Extension at 72°C (time based on amplicon length)

      • Final extension at 72°C for 10 min

  • Sequence Analysis: Analyze amplicons by gel electrophoresis, purify products, and perform Sanger sequencing to confirm identity.

What are the optimal expression systems for producing recombinant A. suum COII protein?

The selection of an optimal expression system for recombinant A. suum COII requires consideration of several factors including codon usage, post-translational modifications, and protein folding requirements. Based on research approaches with similar mitochondrial membrane proteins:

Eukaryotic Systems:

  • Insect cells: The baculovirus expression system in Sf9 or Hi5 cells may provide superior folding and assembly of complex membrane proteins like COII.

  • Yeast systems: Pichia pastoris and Saccharomyces cerevisiae can offer advantages for membrane protein expression, including proper folding machinery and the ability to grow to high cell densities.

For A. suum COII expression, a cell-free system might also be considered when proper folding is critical and membrane incorporation is required. This approach allows for the direct incorporation of the protein into artificial membranes during synthesis.

How can non-synonymous mutations in recombinant A. suum COII be identified and what is their functional significance?

Non-synonymous mutations in recombinant A. suum COII can significantly impact protein function and should be carefully identified and characterized. The methodological approach involves:

  • Sequence alignment and analysis: Align the recombinant COII sequence with reference sequences using tools like MUSCLE or CLUSTAL W. Focus on conserved regions that are functionally important.

  • Mutation identification: Analyze the alignment to identify base substitutions that change amino acids. For COII, certain mutation sites have been identified in comparative studies between Ascaris and related genera .

  • Functional prediction: Use tools like PROVEAN, SIFT, or PolyPhen-2 to predict the functional impact of identified mutations.

  • Experimental validation: Validate predictions through:

    • Site-directed mutagenesis to create variants

    • Enzymatic activity assays comparing wild-type and mutant proteins

    • Structural analysis using techniques like circular dichroism

Research has shown that specific non-synonymous substitutions in Ascaris COII can lead to amino acid changes that may affect enzyme function. For example, studies comparing ascaridoid parasites identified six specific amino acid changes resulting from non-synonymous substitutions in cox2, including positions 25:K/R/S(Val/Arg/Ser) → C(Ilu), 135:G(Gly) → S(Ser), and 167:V/I(Val/Ilu) → L(Leu) . These changes may have functional implications for protein activity, stability, or interactions with other components of the cytochrome c oxidase complex.

What approaches can be used to ensure proper folding and functional characterization of recombinant A. suum COII?

Ensuring proper folding and functional characterization of recombinant A. suum COII involves multiple complementary approaches:

Strategies for proper folding:

  • Detergent screening: Test multiple detergents (e.g., DDM, LMNG, CHAPS) for solubilization and stabilization of the membrane protein.

  • Chaperone co-expression: Co-express molecular chaperones like GroEL/ES or DnaK/J systems to assist proper folding.

  • Fusion partners: Employ fusion partners known to enhance folding and solubility (e.g., thioredoxin, MBP, or SUMO tags).

  • Refolding protocols: If expressed as inclusion bodies, develop optimized refolding protocols using gradual dilution methods with specific lipid compositions.

Functional characterization methods:

  • Spectroscopic analysis: Use UV-visible spectroscopy to assess heme incorporation and redox properties of the cytochrome.

  • Oxygen consumption assays: Measure oxygen consumption rates to assess enzymatic activity.

  • Reconstitution into proteoliposomes: Incorporate purified COII into artificial membrane systems to assess native-like behavior.

  • Electron transport chain coupling: Assess the ability to couple with other components of the electron transport chain.

The functional characterization should include comparisons with native COII extracted directly from A. suum mitochondria as a benchmark for proper folding and activity.

What are the optimized PCR conditions for amplifying A. suum COII for recombinant expression?

When amplifying A. suum COII specifically for recombinant expression, the standard PCR conditions need to be optimized to incorporate features that facilitate subsequent cloning steps. The following optimized protocol is recommended:

Optimized PCR conditions:

  • Primer design:

    • Forward primer: Include appropriate restriction sites or sequences for directional cloning

    • Example: 5′-[RESTRICTION SITE]-[KOZAK SEQUENCE]-CAC CAA CTC TTA AAA TTA TC-3′

    • Reverse primer: Include restriction site and consider removing the stop codon if C-terminal tags are desired

    • Example: 5′-[RESTRICTION SITE]-TTT TCT AGT TAT ATA GAT TGR TTT YAT-3′

    • Consider adding a 6-base flanking sequence before restriction sites to improve enzyme cutting efficiency

  • PCR reaction mixture (50 μl):

    • 25 μl high-fidelity PCR master mix (e.g., Q5 or Phusion polymerase)

    • 3 μl genomic DNA (10-50 ng/μl)

    • 16 μl nuclease-free water

    • 3 μl of each primer (10 pmol/μl)

  • Optimized thermal cycling conditions:

    • Initial denaturation: 98°C for 30 seconds

    • 35 cycles of:

      • Denaturation: 98°C for 10 seconds

      • Annealing: 44-52°C (gradient recommended to optimize) for 30 seconds

      • Extension: 72°C for 30 seconds (based on COII fragment length)

    • Final extension: 72°C for 2 minutes

    • Hold at 4°C

  • Product verification:

    • Analyze 5 μl on a 1% agarose gel to confirm the expected 582 bp product

    • Purify remaining product using a column-based purification kit

    • Sequence verify before proceeding to cloning steps

What are the critical considerations for designing A. suum COII constructs for different expression systems?

Designing optimal A. suum COII constructs requires careful consideration of the expression system, protein characteristics, and experimental objectives. Here are the critical factors to consider:

For bacterial expression systems (E. coli):

  • Codon optimization: Adjust codon usage to match E. coli preferences, especially considering the high A+T content (66.5%) of A. suum COII .

  • Signal sequences: Remove native mitochondrial targeting sequences which may interfere with bacterial expression.

  • Fusion tags: Consider N-terminal fusion tags like 6xHis, MBP, or SUMO to improve solubility and facilitate purification.

  • Solubility enhancement: Include solubility-enhancing domains for this membrane protein.

  • Protease sites: Include specific protease cleavage sites between the tag and COII.

For eukaryotic expression systems (insect/mammalian cells):

  • Kozak sequence: Include appropriate Kozak consensus sequence for efficient translation initiation.

  • Signal sequences: Consider replacing the native mitochondrial targeting sequence with a system-appropriate signal.

  • Glycosylation sites: Analyze and potentially modify glycosylation sites if they affect function.

  • Codon usage: Optimize codons for the specific host cell line.

General considerations:

  • Affinity tags: Position tags (N- or C-terminal) based on structural predictions to minimize interference with protein folding.

  • Cleavage sites: Include TEV or PreScission protease sites for tag removal during purification.

  • Flexible linkers: Use glycine-serine linkers between domains to improve folding.

  • Expression monitoring: Incorporate reporter tags (GFP fusion) for expression monitoring when appropriate.

The table below summarizes recommended construct features for different expression systems:

FeatureE. coli SystemInsect Cell SystemMammalian Cell System
Codon optimizationEssentialBeneficialBeneficial
Signal sequenceRemove nativeReplace with BIP/gp67Replace with mammalian
Recommended tags6xHis-MBP, SUMO6xHis, FLAG6xHis, Fc fusion
Solubility elementsThioredoxin, GSTNot typically neededNot typically needed
PromoterT7, tacPolyhedrin, p10CMV, EF1α
Special considerationsLow temperature inductionConsider secreted versionStable vs. transient

What purification strategies yield the highest recovery of functional recombinant A. suum COII?

Purifying functional recombinant A. suum COII requires specialized approaches due to its nature as a membrane protein. The following purification strategy is recommended:

Step 1: Membrane isolation and solubilization

  • Harvest cells and resuspend in lysis buffer (typically 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 5% glycerol, protease inhibitors).

  • Disrupt cells by sonication or pressure-based methods.

  • Remove cell debris by centrifugation at 10,000 × g for 20 minutes.

  • Isolate membranes by ultracentrifugation at 100,000 × g for 1 hour.

  • Solubilize membrane fraction in buffer containing appropriate detergent:

    • Primary recommendation: 1% n-Dodecyl β-D-maltoside (DDM)

    • Alternatives: 1% LMNG, 1% digitonin, or 0.5% CHAPS

    • Solubilize for 1-2 hours at 4°C with gentle rotation

Step 2: Affinity chromatography

  • Apply solubilized sample to appropriate affinity resin based on fusion tag:

    • For His-tagged COII: Ni-NTA or TALON resin

    • For MBP-tagged COII: Amylose resin

  • Wash extensively with buffer containing reduced detergent concentration (typically 0.05-0.1% DDM).

  • Elute with appropriate competitive agent (imidazole for His-tags, maltose for MBP-tags).

Step 3: Secondary purification

  • Size exclusion chromatography using a Superdex 200 column equilibrated with buffer containing 0.05% DDM.

  • Collect fractions corresponding to the appropriate molecular weight for COII.

Step 4: Validation of functional status

  • Analyze protein purity by SDS-PAGE and Western blot.

  • Perform spectroscopic analysis to confirm heme incorporation.

  • Conduct functional assays to verify enzyme activity.

Yield optimization considerations:

  • Throughout purification, maintain strictly controlled temperature (4°C).

  • Include stabilizing agents in all buffers (5-10% glycerol).

  • Add specific lipids (0.01-0.05 mg/ml cardiolipin) to stabilize the protein.

  • Consider using amphipols or nanodiscs for final storage to maintain native-like environment.

This methodical approach typically yields 1-5 mg of functional protein per liter of bacterial culture or 5-15 mg per liter of insect cell culture.

How can recombinant A. suum COII be used for vaccine development research?

Recombinant A. suum COII represents a promising candidate for vaccine development against ascariasis, which is the most prevalent helminth infection globally and causes significant morbidity, particularly in children . The methodological approach for using recombinant A. suum COII in vaccine research includes:

  • Antigen preparation and characterization:

    • Express and purify recombinant COII using the optimized protocols discussed earlier.

    • Characterize the protein for:

      • Purity (SDS-PAGE, mass spectrometry)

      • Secondary structure (circular dichroism)

      • Antigenicity (ELISA with sera from infected hosts)

    • Assess protein stability under various storage conditions to ensure consistency.

  • Immunogenicity evaluation:

    • Formulate with appropriate adjuvants (e.g., alum, oil-in-water emulsions, TLR agonists).

    • Conduct dose-response studies in animal models to determine optimal antigen concentration.

    • Evaluate humoral responses through:

      • Antibody titers (ELISA)

      • Antibody isotype profiling (IgG1, IgG2a, IgE)

      • Functional assays (neutralization, complement activation)

    • Assess cellular immune responses via:

      • T-cell proliferation assays

      • Cytokine profiling (IL-4, IL-5, IFN-γ, IL-17)

      • Flow cytometry phenotyping

  • Protection studies:

    • Challenge immunized animals with infectious A. suum eggs.

    • Evaluate protection by measuring:

      • Worm burden reduction

      • Egg count reduction

      • Liver lesion reduction

      • Growth parameters in challenged animals

  • Mechanistic studies:

    • Perform adoptive transfer experiments to identify protective immune components.

    • Conduct epitope mapping to identify immunodominant regions.

    • Evaluate potential cross-protection against A. lumbricoides given the high genetic similarity (99% identity) between these species .

Current challenges in Ascaris vaccine development include identifying appropriate animal models and overcoming potential anthelminthic drug resistance . Recombinant protein technology, particularly with conserved antigens like COII, offers promise in generating effective vaccines that could ultimately help break the transmission cycle and lead to disease eradication globally .

What is the role of A. suum COII in phylogenetic studies and species identification?

A. suum COII serves as a valuable molecular marker for phylogenetic studies and species identification due to its specific characteristics. The methodological applications include:

  • Phylogenetic relationship determination:

    • COII sequences provide reliable data for constructing phylogenetic trees using:

      • Bayesian inference (BI) with the general time reversible (GTR) model including gamma-distributed rate variation

      • Maximum likelihood (ML) methods

    • These analytical approaches have successfully resolved relationships within the Ascaridoidea superfamily .

    • COII analyses help resolve the taxonomic status of A. suum and A. lumbricoides, providing evidence that they form a genetic complex capable of interbreeding .

  • Species-specific marker development:

    • The conserved regions in COII allow primer design for broad ascaridoid detection.

    • Variable regions enable species-specific differentiation.

    • Research has identified specific nucleotide positions in COII that are conserved within genera but vary between genera (9 Toxocara-specific sites and 3 Toxascaris-specific sites have been documented) .

  • Hybrid detection methodology:

    • COII sequence analysis contributes to detecting hybridization between A. suum and A. lumbricoides.

    • Combined with whole-genome sequencing, COII analysis has provided evidence for genetic recombination between pig and human Ascaris parasites .

    • This approach has revealed that specimens previously thought to be distinct species are actually genetic recombinants.

  • Evolutionary rate analysis:

    • COII sequences allow calculation of genetic distances between species using the Kimura 2-parameter (K2P) model .

    • These calculations help estimate divergence times between ascaridoid lineages.

    • The AT bias (66.5%) in COII sequences provides insights into molecular evolution patterns in nematode mitochondrial genes .

These applications of COII analysis have significant implications for understanding Ascaris epidemiology, highlighting that both A. suum and A. lumbricoides may be important in human disease and supporting the need for a one-health approach to control human ascariasis .

How can recombinant A. suum COII contribute to understanding drug resistance mechanisms?

Recombinant A. suum COII can serve as a valuable tool for investigating anthelminthic drug resistance mechanisms, which represent a growing concern in ascariasis control. The methodological approaches include:

  • Drug binding and interaction studies:

    • Utilize purified recombinant COII to investigate direct interactions with anthelminthic drugs through:

      • Surface plasmon resonance (SPR) to measure binding kinetics

      • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

      • Fluorescence-based binding assays to visualize interactions

    • Develop COII-based screening assays for new drug candidates targeting mitochondrial function.

  • Structural studies of resistance-associated mutations:

    • Express recombinant COII variants containing mutations associated with drug resistance.

    • Compare structural characteristics of wild-type and mutant proteins using:

      • X-ray crystallography or cryo-EM for high-resolution structures

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

      • Circular dichroism for secondary structure analysis

    • Correlate structural changes with altered drug interactions.

  • Functional impact assessment:

    • Measure the enzymatic activity of wild-type and mutant COII proteins in:

      • Reconstituted membrane systems

      • Proteoliposomes with defined lipid compositions

      • Cell-based assays when possible

    • Determine how mutations affect both baseline activity and response to drug treatment.

    • Evaluate potential fitness costs associated with resistance mutations.

  • Systems biology integration:

    • Combine recombinant COII studies with transcriptomics and metabolomics data from resistant isolates.

    • Map COII interactions with other mitochondrial proteins in the presence and absence of drugs.

    • Develop predictive models for the emergence and spread of resistance based on molecular findings.

This multi-faceted approach using recombinant COII contributes to the development of new strategies to overcome anthelminthic resistance, which is critical given the challenges of high re-infection rates and emerging drug resistance in ascariasis control efforts . The integration of molecular-level understanding with epidemiological data can inform more effective treatment regimens and resistance management strategies.

How can molecular variations in A. suum COII sequence be used to track transmission patterns?

Molecular variations in A. suum COII sequences provide valuable markers for tracking transmission patterns and understanding the epidemiology of ascariasis. The methodological approach includes:

  • Sampling and sequence acquisition:

    • Collect Ascaris specimens from diverse geographical locations and hosts.

    • Amplify and sequence the COII gene using standardized protocols:

      • Use primers targeting conserved regions: Forward: 5′-CAC CAA CTC TTA AAA TTA TC-3′ and Reverse: 5′-TTT TCT AGT TAT ATA GAT TGR TTT YAT-3′

      • Employ high-fidelity polymerase to minimize amplification errors

      • Sequence in both directions to ensure accuracy

    • Deposit sequences in public databases with comprehensive metadata.

  • Haplotype network analysis:

    • Align COII sequences and identify haplotypes (unique sequence variants).

    • Construct haplotype networks using software like TCS or Network.

    • Analyze haplotype distribution across geographical regions and host species.

    • Calculate haplotype diversity indices to quantify genetic variability.

  • Population genetics analysis:

    • Calculate population genetic parameters:

      • Nucleotide diversity (π)

      • Fixation indices (FST) between populations

      • Tajima's D and Fu's FS to detect demographic events or selection

    • Perform AMOVA (Analysis of Molecular Variance) to partition genetic variation.

    • Use coalescent-based approaches to estimate gene flow between populations.

  • Transmission pattern inference:

    • Identify shared haplotypes between human and pig hosts to detect cross-species transmission.

    • Analyze genetic recombination patterns to detect hybridization events between A. suum and A. lumbricoides .

    • Correlate COII variants with host factors, geographical distribution, and control interventions.

    • Develop models predicting transmission dynamics based on molecular data.

This approach has revealed important epidemiological insights, including evidence of a recent worldwide, multi-species Ascaris population expansion caused by human and livestock movement globally . The high genetic similarity between A. suum and A. lumbricoides (99% genomic identity) and evidence of hybridization highlight the complex transmission dynamics of ascariasis and emphasize the need for integrated control strategies addressing both human and animal infections .

What bioinformatic approaches are recommended for analyzing A. suum COII sequence data?

Comprehensive bioinformatic analysis of A. suum COII sequence data requires a systematic approach using multiple computational tools. The recommended methodology includes:

  • Sequence quality assessment and processing:

    • Use FastQC for initial quality control of raw sequencing data.

    • Apply Trimmomatic or similar tools to remove low-quality reads and adapter sequences.

    • Assemble contigs using SPAdes or MEGAHIT if working with next-generation sequencing data.

  • Multiple sequence alignment:

    • Align sequences using MUSCLE, MAFFT, or CLUSTAL for accuracy with closely related sequences.

    • Refine alignments using Gblocks to remove poorly aligned positions .

    • Visualize alignments with tools like Jalview or AliView to inspect conservation patterns.

  • Evolutionary model selection and phylogenetic analysis:

    • Determine the best-fit evolutionary model using jModelTest or ModelTest.

    • For COII, the general time reversible (GTR) model with gamma-distributed rate variation (GTR+G) is often appropriate .

    • Construct phylogenetic trees using:

      • Bayesian inference with MrBayes 3.1.2

      • Maximum likelihood methods with PHYML 3.0

    • Assess tree reliability through bootstrap analysis (1000 replicates) or posterior probabilities.

  • Genetic distance and diversity analysis:

    • Calculate genetic distances using the Kimura 2-parameter (K2P) model in MEGA .

    • Analyze nucleotide diversity (π) and haplotype diversity (Hd) using DnaSP.

    • Identify parsimony-informative sites (approximately 135 for COII in ascaridoids) .

    • Analyze A+T content (typically around 66.5% for A. suum COII) .

  • Mutation and selection analysis:

    • Identify synonymous and non-synonymous substitutions using PAML or HyPhy.

    • Calculate dN/dS ratios to detect selection pressures.

    • Map mutations to protein structure using tools like PyMOL if structural data is available.

    • Identify conserved species-specific sites that can serve as diagnostic markers .

These bioinformatic approaches have successfully revealed important features of A. suum COII, including its phylogenetic relationships with other ascaridoids and evidence of genetic exchange between A. suum and A. lumbricoides, supporting a model in which these traditionally distinct species form a hybrid complex .

How should researchers interpret conflicting phylogenetic signals in A. suum COII data?

Interpreting conflicting phylogenetic signals in A. suum COII data requires a systematic approach to distinguish biological phenomena from methodological artifacts. The recommended methodology includes:

  • Identification of potential conflict sources:

    • Assess sequence quality and alignment reliability:

      • Check for sequencing errors, especially in homopolymeric regions

      • Evaluate alignment gaps and ambiguous positions

      • Consider applying Gblocks to remove poorly aligned segments

    • Examine potential biological sources of conflict:

      • Hybridization between species (particularly relevant for A. suum and A. lumbricoides)

      • Incomplete lineage sorting

      • Introgression or horizontal gene transfer

      • Heteroplasmy in mitochondrial DNA

  • Multi-faceted analytical approach:

    • Apply multiple phylogenetic reconstruction methods:

      • Compare trees generated by Bayesian inference, maximum likelihood, and distance-based methods

      • Evaluate congruence between different optimality criteria

    • Implement partition analysis:

      • Analyze different gene regions separately

      • Use partition homogeneity test to assess congruence

    • Apply network-based approaches:

      • Construct median-joining or statistical parsimony networks

      • These can better represent reticulate evolution than bifurcating trees

  • Statistical evaluation:

    • Assess node support through:

      • Bootstrap analysis (values >70% indicate strong support)

      • Posterior probabilities in Bayesian analysis (values >0.95 indicate strong support)

    • Implement topology tests:

      • Shimodaira-Hasegawa (SH) test

      • Approximately Unbiased (AU) test

      • These can determine if alternative topologies are significantly worse than the best tree

  • Integration with additional markers:

    • Compare COII-based phylogenies with trees from:

      • Other mitochondrial genes (nad1, cox1)

      • Nuclear markers (ITS regions)

      • Whole genome data when available

    • When markers conflict, consider that mitochondrial genes like COII reflect maternal lineage, while nuclear genes reflect biparental inheritance.

This approach has proven valuable in resolving the complex relationship between A. suum and A. lumbricoides, revealing that what were once considered distinct species actually represent a genetic complex capable of interbreeding . The mitochondrial COII gene, when analyzed alongside whole-genome data, provides evidence for hybridization and genetic recombination between pig and human Ascaris, supporting a model of recent worldwide population expansion .

How might recombinant A. suum COII contribute to developing pan-helminthic vaccines?

Recombinant A. suum COII has significant potential to contribute to the development of pan-helminthic vaccines due to sequence conservation across nematode species. The methodological approach for exploring this application includes:

  • Comparative sequence analysis for epitope identification:

    • Align COII sequences from multiple helminth species including:

      • Ascaris species

      • Other soil-transmitted helminths (Trichuris, hookworms)

      • Filarial nematodes

    • Identify highly conserved regions that could serve as targets for broad-spectrum protection.

    • Use in silico epitope prediction tools to identify:

      • B-cell epitopes (linear and conformational)

      • T-cell epitopes (MHC class I and II binding)

    • Prioritize epitopes based on conservation, accessibility, and predicted immunogenicity.

  • Structure-based vaccine design:

    • Determine the three-dimensional structure of recombinant COII through:

      • X-ray crystallography

      • Cryo-electron microscopy

      • Computational modeling based on homologous proteins

    • Map conserved epitopes onto the structure to confirm surface exposure.

    • Design chimeric constructs that present multiple conserved epitopes.

    • Engineer structure-stabilized immunogens that maintain native epitope conformation.

  • Cross-species immunogenicity testing:

    • Express and purify recombinant COII constructs.

    • Formulate with appropriate adjuvants selected for helminth applications.

    • Evaluate immune responses in animal models against multiple helminth challenges:

      • Measure cross-reactive antibody responses

      • Assess T-cell activation against multiple parasite antigens

      • Determine protection levels against different helminth species

  • Combination vaccine approaches:

    • Integrate COII epitopes with other conserved helminth targets.

    • Develop multivalent constructs presenting epitopes from multiple parasite stages.

    • Evaluate prime-boost strategies using different delivery platforms.

    • Test novel adjuvant formulations designed to enhance Th2/regulatory responses.

This approach aligns with the recognized need for new tools to control and potentially eradicate helminthic infections like ascariasis, where current control methods face challenges including high reinfection rates and emerging drug resistance . The advancement in recombinant protein technology presents a promising path for generating not only an Ascaris vaccine but potentially a pan-helminthic vaccine that could address multiple parasitic diseases simultaneously .

What novel applications of A. suum COII could emerge from combining molecular and structural studies?

The integration of molecular and structural studies of A. suum COII opens avenues for innovative applications beyond traditional research areas. The methodological approaches for these emerging applications include:

  • Rational drug design targeting COII:

    • Determine high-resolution structures of A. suum COII using:

      • X-ray crystallography

      • Cryo-electron microscopy

      • Computational modeling validated by experimental data

    • Identify druggable pockets unique to parasite COII versus host cytochrome oxidases.

    • Perform virtual screening of compound libraries against identified targets.

    • Validate hits through binding assays and functional studies.

    • Develop structure-activity relationships (SAR) for lead optimization.

  • Biomarker development for infection monitoring:

    • Identify COII-derived peptides released during infection.

    • Develop sensitive detection methods:

      • Antibody-based assays targeting COII epitopes

      • Mass spectrometry detection of COII fragments in host fluids

      • Aptamer-based detection platforms

    • Correlate COII biomarker levels with infection intensity and treatment efficacy.

    • Create point-of-care diagnostic tools based on COII detection.

  • Synthetic biology applications:

    • Engineer modified COII proteins with enhanced properties:

      • Increased stability for biosensor applications

      • Altered substrate specificity for biotechnological processes

      • Fusion proteins combining COII with functional domains

    • Develop COII-based biocatalysts for industrial applications.

    • Create synthetic metabolic pathways incorporating engineered COII variants.

  • Nanoparticle delivery systems:

    • Design self-assembling nanoparticles displaying COII epitopes.

    • Create biomimetic delivery systems targeting parasitic worms.

    • Develop COII-targeting nanoparticles for selective drug delivery to helminths.

    • Engineer stimuli-responsive systems triggered by parasite-specific conditions.

These innovative applications build upon the growing understanding of A. suum molecular biology and could contribute to overcoming challenges in ascariasis control. The convergence of structural biology, molecular engineering, and nanobiotechnology with parasitology creates opportunities for transformative approaches to helminth control, potentially addressing the limitations of current strategies facing high reinfection rates and emerging drug resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.