Recombinant Ascaris suum Cytochrome c oxidase subunit 3 (COIII)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant COIII is produced via heterologous expression in Escherichia coli systems, often fused with a His-tag for purification . Key features include:

  • Gene Source: Encoded by the COIII gene (UniProt ID: P24879) from Ascaris suum .

  • Protein Length: 255 amino acids (partial or full-length constructs available) .

  • Molecular Weight: Approximately 30 kDa .

  • Structural Domains: Contains seven transmembrane helices, typical of cytochrome c oxidase subunits .

Table 1: Biochemical Properties of Recombinant COIII

PropertyDetail
Expression SystemE. coli
Purification TagHis-tag (N-terminal)
Storage Conditions-20°C in Tris buffer with 50% glycerol; avoid freeze-thaw cycles
Key EpitopesB-cell epitopes involved in immune recognition

Functional Role in Mitochondrial Respiration

COIII is a core subunit of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. It facilitates:

  • Electron transfer from cytochrome c to molecular oxygen, coupled with proton pumping across the mitochondrial membrane .

  • The reaction: 4cytc2++4H++O24cytc3++2H2O4 \, \text{cyt} \, c^{2+} + 4 \, \text{H}^+ + \text{O}_2 \rightarrow 4 \, \text{cyt} \, c^{3+} + 2 \, \text{H}_2\text{O} .

Immunogenicity and Vaccine Development

Recombinant COIII has been evaluated in preclinical trials for ascariasis control:

  • Protective Immunity: In pigs, intranasal immunization with COIII-derived antigens induced IgG and IgA antibodies, reducing larval migration by 58% .

  • Mechanism: Antibodies bind larval digestive tracts, inhibiting molting and survival .

  • Multi-Epitope Vaccines: COIII epitopes are incorporated into chimeric vaccines like ASCVac-1, which showed 60–65% efficacy in reducing parasite burden in mice .

Table 2: Vaccine Efficacy of COIII-Containing Antigens

Antigen FormHostEfficacy (% Larval Reduction)Key Immune Response
Recombinant COIII + CTPig58%IgG1, IL-4, IL-10
ASCVac-1 (Multi-Epitope)Mouse60–65%Th2-polarized IgG

Challenges and Future Directions

  • Stability Issues: Recombinant COIII requires stringent storage conditions (-80°C) to retain activity .

  • Adjuvant Dependency: Optimal immune responses require adjuvants like cholera toxin (CT) .

  • Human Trials: No data exists yet; current research is limited to animal models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
COIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
Target Names
COIII
Target Protein Sequence
MFHNFHILSLSSYPILIFCSSLGFTSSLVVFFKNGIFGGLLFCLFSIFLVSFAWGKDIVM EGLSGYHNFFVMDGFKFGVLVFIFSEFMFFFGIFWTFFDAALVPAHDVGGVWSPIGMHLV NPFGVPLLNTIILLSSGVSVTWAHYSLLSNKGCANSLMLTCILAVYFTGIQLMEYKEASF SISDGIFGSIFYLSTGFHGVHVLFGGLFLFFNLLRLLMSHFNYNHHLGLEFAIIYWHFVD VVWLFLFVFVYWWSY
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COIII) is a crucial component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work collaboratively to transfer electrons originating from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons derived from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This site is a binuclear center (BNC) composed of heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Cytochrome c oxidase subunit III in Ascaris suum?

Cytochrome c oxidase subunit III (COIII) in Ascaris suum is a transmembrane protein that functions as a critical component of the respiratory chain. Similar to human COIII (encoded by MT-CO3), the A. suum COIII likely contains multiple transmembrane domains positioned within the inner mitochondrial membrane . The protein serves as one of the core subunits of cytochrome c oxidase, which functions as the terminal enzyme in the respiratory chain of mitochondria, catalyzing the transfer of electrons from reduced cytochrome c to molecular oxygen . This reaction is coupled to the pumping of protons across the mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis.

The COIII subunit specifically plays a role in maintaining the structural integrity of the enzyme complex and may be involved in proton translocation, though its exact contribution to enzyme function in A. suum requires further characterization through recombinant expression and functional studies.

How does A. suum COIII expression differ across tissues and developmental stages?

A. suum COIII expression demonstrates significant tissue-specific patterns across different organs and between male and female worms. Research using cDNA microarray analysis has revealed distinct gene expression signatures that characterize and discriminate among various A. suum tissues . Gender-specific distinctions have been observed for several tissues, with expression patterns that can be used to parse gene family members according to tissue-specific expression .

The tissue-specific expression of COIII likely reflects the varying energy demands across different anatomical regions of the parasite. Researchers should consider these differential expression patterns when designing experiments, particularly when selecting tissue samples for recombinant protein production or when studying the functional significance of COIII in specific tissues.

What are the key differences between A. suum COIII and human cytochrome c oxidase?

While both human and A. suum COIII serve as components of cytochrome c oxidase, there are several important structural and functional differences that researchers should consider:

FeatureHuman COIIIA. suum COIII
Genomic locationMitochondrial DNA (MT-CO3)Mitochondrial DNA
Protein size30 kDa, 261 amino acidsSpecies-specific variation
Transmembrane domains7 domains at positions 15-35, 42-59, 81-101, 127-147, 159-179, 197-217, and 239-259Presumed similar arrangement but with parasite-specific variations
Associated pathologiesVariants linked to myopathy, encephalomyopathy, Leber hereditary optic neuropathyUnknown - may affect parasite metabolism
RNA editingNot extensively editedMay undergo RNA editing similar to T. brucei COIII

These differences may provide opportunities for parasite-specific targeting in research applications. The potential for RNA editing in A. suum COIII (based on observations in T. brucei) suggests another layer of post-transcriptional regulation that may not be present in the human ortholog .

What are the optimal methods for recombinant expression of A. suum COIII?

Recombinant expression of A. suum COIII presents several technical challenges due to its transmembrane nature and potential RNA editing. Researchers should consider the following methodological approaches:

  • Expression System Selection: For membrane proteins like COIII, eukaryotic expression systems such as insect cells (Sf9, High Five) or yeast (Pichia pastoris) often yield better results than bacterial systems. These platforms provide the necessary cellular machinery for proper folding and post-translational modifications.

  • Construct Design:

    • Include appropriate purification tags (His, FLAG, etc.) positioned to avoid interference with protein folding

    • Consider using fusion partners (MBP, SUMO, etc.) to enhance solubility

    • Optimize codon usage for the expression system

    • Include appropriate signal sequences for membrane targeting

  • RNA Editing Considerations: If A. suum COIII undergoes RNA editing similar to that observed in T. brucei , researchers may need to use the fully edited cDNA sequence rather than the genomic sequence for expression. Analysis of partially edited COIII RNAs suggests that editing proceeds in the 3' to 5' direction, which should inform construct design strategies.

  • Purification Strategy: Use mild detergents (DDM, LMNG) for membrane protein extraction and maintain detergent throughout purification to prevent aggregation.

  • Functional Validation: Assess activity through cytochrome c oxidation assays or artificial liposome reconstitution to confirm proper folding and function.

How can researchers effectively study the immunological implications of A. suum COIII in host-parasite interactions?

Recent research has demonstrated that A. suum can infect humans and elicit specific immune responses, making COIII a potential target for immunological studies . When designing experiments to investigate the immunological implications of A. suum COIII, researchers should consider:

  • Antigen Preparation:

    • Use highly purified recombinant COIII to avoid contamination with bacterial proteins

    • Consider both full-length protein and peptide fragments representing immunogenic epitopes

    • Ensure proper folding of recombinant proteins through appropriate validation techniques

  • Immune Response Characterization:

    • Evaluate both humoral (antibody) and cellular immune responses

    • Measure cytokine profiles to determine polarization (Th1, Th2, Th17)

    • Research has shown that A. suum infection leads to Th2/Th17 responses with downregulation of Th1-related genes

  • Cross-reactivity Analysis:

    • Test for cross-reactivity with human COIII to assess potential autoimmune implications

    • Evaluate cross-protection against related helminths

  • Experimental Models:

    • The CBA/Ca (resistant) and C57BL/6J (susceptible) mouse models provide valuable platforms for studying differential immune responses to A. suum

    • These models show distinct differences in complement activation, with CBA/Ca mice showing higher abundance of lectin pathway proteins and C57BL/6J mice showing higher abundance of complement-inhibiting proteins

  • Gene Expression Analysis:

    • Use RNA-seq or microarray approaches to assess host gene expression changes in response to COIII exposure

    • Integrate proteomic data to validate transcriptional findings

What techniques are most effective for investigating RNA editing in A. suum COIII transcripts?

Based on findings from T. brucei COIII , RNA editing through addition and deletion of uridines may be an important regulatory mechanism for A. suum COIII. Researchers investigating this process should consider:

  • RNA Isolation Optimization:

    • Use methods that preserve RNA integrity and capture partially edited transcripts

    • Consider subcellular fractionation to enrich for mitochondrial RNA

  • Sequencing Approaches:

    • Direct RNA sequencing (native RNA-seq) to capture modifications

    • cDNA sequencing with multiple primers to capture partially edited forms

    • Pacific Biosciences or Oxford Nanopore long-read sequencing to capture full-length transcripts with their edits

  • Bioinformatic Analysis:

    • Specialized pipelines to detect insertion/deletion of uridines

    • Alignment of RNA-seq data to genomic sequence to identify editing sites

    • Analysis of partially edited RNAs to determine editing patterns and progression (likely 3' to 5' as in T. brucei)

  • Functional Validation:

    • In vitro editing assays with purified editing machinery

    • Expression of edited and unedited forms to compare functional properties

  • Guide RNA Identification:

    • Techniques to identify small RNAs that guide the editing process

    • Crosslinking approaches to capture RNA-protein interactions in the editing complex

How should researchers design experiments to study the role of A. suum COIII in parasite metabolism and survival?

When investigating the metabolic significance of COIII in A. suum, researchers should consider these experimental design elements:

  • RNA Interference (RNAi) Approaches:

    • Design siRNAs targeting COIII mRNA with appropriate controls

    • Assess knockdown efficiency through qRT-PCR and western blotting

    • Measure metabolic parameters (oxygen consumption, ATP production) following knockdown

  • Metabolic Flux Analysis:

    • Use isotope-labeled substrates to track metabolic pathways

    • Compare flux patterns between normal and COIII-compromised parasites

    • Integrate with proteomics data to correlate protein abundance with metabolic activity

  • Inhibitor Studies:

    • Identify compounds that specifically target A. suum COIII

    • Determine dose-response relationships and specificity

    • Assess metabolic and survival impacts of inhibition

  • Environmental Stress Testing:

    • Evaluate COIII expression and function under various oxygen tensions

    • Test the impact of host-derived stress factors on COIII activity

    • Assess COIII role in adaptation to different microenvironments within the host

  • Lifecycle Stage Analysis:

    • Compare COIII expression and function across different developmental stages

    • Identify critical periods where COIII activity is essential for parasite survival

What are the key considerations when comparing oxidative phosphorylation in A. suum with model organisms?

Research with mouse models has revealed significant differences in oxidative phosphorylation between resistant and susceptible strains . When extending these comparisons to include A. suum, researchers should consider:

  • Model Selection:

    • The CBA/Ca (resistant) mouse strain shows higher abundance of oxidative phosphorylation proteins compared to C57BL/6J (susceptible)

    • Consider how these differences might relate to A. suum's own oxidative phosphorylation system

  • Environmental Adaptation:

    • A. suum inhabits low-oxygen environments and may have adapted its respiratory chain accordingly

    • Design experiments that mimic the parasite's natural environment rather than standard laboratory conditions

  • Tissue-Specific Analysis:

    • Different A. suum tissues show distinct gene expression patterns

    • Design tissue-specific analyses of oxidative phosphorylation components

  • Developmental Regulation:

    • Consider how COIII and other respiratory components change during the parasite's lifecycle

    • Design longitudinal studies that capture these developmental transitions

  • Comparative Data Analysis:

    • Use principal component analysis (PCA) to identify patterns in proteomics or transcriptomics data

    • Apply hierarchical clustering to identify co-regulated genes or proteins

OrganismOxidative Phosphorylation CharacteristicsExperimental Implications
A. suumAdaptation to low oxygen environments; tissue-specific expression patternsUse microaerobic culture conditions; isolate specific tissues for analysis
CBA/Ca mice (resistant)Higher abundance of OXPHOS proteins Potential model for efficient energy production
C57BL/6J mice (susceptible)Lower abundance of OXPHOS proteins; higher abundance of drug metabolism proteins Potential model for alternative metabolic strategies
T. bruceiRNA editing of COIII critical for function Consider RNA editing in functional studies of A. suum COIII

How should researchers interpret proteomic data related to A. suum COIII in the context of host-parasite interactions?

When analyzing proteomic data involving A. suum COIII, researchers should follow these interpretative frameworks:

  • Differential Abundance Analysis:

    • Compare COIII levels across experimental conditions using appropriate statistical methods

    • Consider post-translational modifications that may affect protein function without changing abundance

    • Normalize data appropriately to account for technical variations

  • Protein Interaction Networks:

    • Identify proteins that co-purify or co-regulate with COIII

    • Construct interaction networks to understand functional relationships

    • Consider both parasite and host proteins in interaction studies

  • Host Response Integration:

    • Correlate A. suum COIII expression with host immune markers

    • Principal component analysis (PCA) has shown that A. suum infection leads to significant changes in the immune landscape of human hosts

    • Consider how COIII might contribute to the observed Th2/Th17 responses

  • Complement System Analysis:

    • Studies in mice have shown strain-specific differences in complement activation during A. suum infection

    • Investigate whether COIII interacts with or modulates complement components

    • Consider how such interactions might influence parasite survival

  • Functional Annotation:

    • Map proteomic findings to gene models in the A. suum genome database

    • Utilize resources like the mappings provided in supplementary files under GEO accession number GSE36690

What are the implications of A. suum COIII research for understanding mitochondrial evolution in parasites?

Research on A. suum COIII provides valuable insights into mitochondrial evolution in parasitic organisms:

  • Evolutionary Rate Analysis:

    • Compare sequence conservation of COIII across parasitic and free-living nematodes

    • Assess selection pressures on different domains of the protein

    • Identify parasite-specific adaptations that may reflect host environment

  • RNA Editing Comparisons:

    • If A. suum COIII undergoes RNA editing similar to T. brucei , this may represent a shared evolutionary strategy

    • Compare editing patterns across species to understand evolutionary conservation of this process

    • Investigate whether editing provides adaptive advantages in parasitic lifestyles

  • Metabolic Adaptation Analysis:

    • Evaluate how COIII structure relates to the parasite's energy requirements

    • Consider adaptations to low oxygen environments encountered during lifecycle

    • Compare with free-living relatives to identify parasite-specific features

  • Cross-Species Functional Studies:

    • Test functional complementation across species

    • Evaluate whether A. suum COIII can restore function in COIII-deficient systems from other organisms

    • Identify key residues responsible for species-specific functions

  • Horizontal Gene Transfer Assessment:

    • Investigate potential horizontal gene transfer events involving COIII

    • Consider the evolutionary implications of such transfers for parasite adaptation

How can findings from A. suum COIII research contribute to understanding human mitochondrial disorders?

Research on A. suum COIII may provide valuable insights for human health applications:

  • Disease Modeling:

    • A. suum COIII could serve as a model system for studying basic aspects of cytochrome c oxidase function

    • Variants of human COIII have been associated with multiple disorders including isolated myopathy, severe encephalomyopathy, and Leber hereditary optic neuropathy

    • Comparative studies may reveal conserved functional principles

  • Therapeutic Target Identification:

    • Structural differences between human and parasite COIII may be exploited for selective targeting

    • Understanding these differences at the molecular level could inform drug design

  • RNA Editing Insights:

    • If A. suum COIII undergoes RNA editing, this may provide a model system for studying this process

    • RNA editing mechanisms may have implications for understanding certain human mitochondrial diseases

  • Immune Response Regulation:

    • A. suum infection studies have revealed a Th2/Th17 response with downregulation of Th1-related genes

    • This immunomodulatory capacity may provide insights for treating inflammatory conditions

  • Oxidative Stress Handling:

    • Parasites must manage oxidative stress within the host environment

    • Understanding how A. suum COIII contributes to this process may inform approaches to oxidative stress-related human diseases

What new methodologies could advance the study of A. suum COIII structure and function?

Several emerging technologies and methodologies hold promise for advancing A. suum COIII research:

  • Cryo-Electron Microscopy:

    • Determination of high-resolution structures of A. suum COIII in its native membrane environment

    • Comparison with human COIII structures to identify parasite-specific features

    • Analysis of protein-protein interactions within the cytochrome c oxidase complex

  • CRISPR/Cas9 Gene Editing:

    • Development of CRISPR systems adapted for A. suum

    • Creation of reporter constructs to monitor COIII expression in living parasites

    • Generation of specific mutations to test structure-function hypotheses

  • Single-Cell Technologies:

    • Application of single-cell RNA-seq to study cell-specific expression of COIII

    • Analysis of heterogeneity in COIII expression within parasite populations

    • Correlation of expression patterns with functional states

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize COIII localization

    • Correlative light and electron microscopy for structural-functional studies

    • Live imaging to track dynamic changes in mitochondrial function

  • Computational Modeling:

    • Molecular dynamics simulations of A. suum COIII

    • Prediction of protein-protein interactions and drug binding sites

    • Integration of multi-omics data through machine learning approaches

How might research on A. suum COIII inform strategies for helminth control?

Understanding A. suum COIII may contribute to parasite control strategies in several ways:

  • Drug Target Validation:

    • Evaluate COIII as a potential drug target through biochemical and genetic approaches

    • Identify parasite-specific features that could be exploited for selective targeting

    • Develop high-throughput screening assays for COIII inhibitors

  • Vaccine Development:

    • Assess COIII immunogenicity in different host species

    • Identify protective epitopes that could be incorporated into vaccine candidates

    • Evaluate cross-protection against related parasitic nematodes

  • Diagnostic Development:

    • Explore COIII-specific antibodies or nucleic acid signatures as diagnostic markers

    • Develop assays to distinguish between A. suum and A. lumbricoides infections

    • Create point-of-care tests based on COIII detection

  • Resistance Monitoring:

    • Study potential mutations in COIII that might confer resistance to treatments

    • Develop molecular assays to detect such mutations in field isolates

    • Model the emergence and spread of resistance in parasite populations

  • Integrated Control Strategies:

    • Understand how COIII contributes to parasite fitness in different environments

    • Identify critical points in the parasite lifecycle where COIII function is essential

    • Design multi-faceted approaches targeting these vulnerabilities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.